Crystal structure of reduced Ost6L. Determined by X-ray diffraction at 1.96 Å resolution. Released 16 Jun 2009.
Explore 3G9B in 3D Show helices and sheets RCSB PDB PDBe
3G9B contains 8 α-helices and 5 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 8-11 | 4 | |
| β-strand | 19-22 | 4 | 1 |
| α-helix | 27-30 | 4 | |
| β-strand | 38-44 | 7 | 1 |
| α-helix | 54-75 | 22 | |
| β-strand | 81-87 | 7 | 1 |
| α-helix | 92-97 | 6 | |
| β-strand | 105-109 | 5 | 1 |
| α-helix | 110-113 | 4 | |
| α-helix | 114-116 | 3 | |
| β-strand | 128-130 | 3 | 1 |
| α-helix | 134-136 | 3 | |
| α-helix | 140-151 | 12 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Dolichyl-diphosphooligosaccharide-protein glycosyltransferase subunit OST6 | A | protein | 178 | Saccharomyces cerevisiae | Q03723 (AlphaFold model) |
>3G9B_1 Dolichyl-diphosphooligosaccharide-protein glycosyltransferase subunit OST6 (chains A) MATASHNIDDILQLKDDTGVITVTADNYPLLSRGVPGYFNILYITMRGTNSNGMSCQLCH DFEKTYHAVADVIRSQAPQSLNLFFTVDVNEVPQLVKDLKLQNVPHLVVYPPAESNKQSQ FEWKTSPFYQYSLVPENAENTLQFGDFLAKILNISITVPQAFNVQEEFHHHHHHHHHH
Oxidoreductase activity of oligosaccharyltransferase subunits Ost3p and Ost6p defines site-specific glycosylation efficiency. Schulz, B.L., Stirnimann, C.U., Grimshaw, J.P. et al. Proc Natl Acad Sci U S A (2009) 106:11061-11066. DOI 10.1073/pnas.0812515106 · PubMed
Other PDB entries of the same protein (UniProt Q03723 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 3G9B directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.