Crystal Structure of Talin2 F2-F3 in Complex with the Integrin Beta1D Cytoplasmic Tail. Determined by X-ray diffraction at 2.17 Å resolution. Released 20 Oct 2009.
Explore 3G9W in 3D Show helices and sheets RCSB PDB PDBe
3G9W contains 28 α-helices and 18 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 195-197 | 3 | |
| β-strand | 202 | 1 | 1 |
| β-strand | 207 | 1 | 1 |
| α-helix | 211-226 | 16 | |
| α-helix | 234-249 | 16 | |
| α-helix | 264-266 | 3 | |
| α-helix | 270-272 | 3 | |
| α-helix | 278-288 | 11 | |
| α-helix | 294-307 | 14 | |
| β-strand | 314-321 | 8 | 2 |
| α-helix | 322 | 1 | |
| β-strand | 328-335 | 8 | 2 |
| β-strand | 339-343 | 5 | 2 |
| β-strand | 350-355 | 6 | 2 |
| α-helix | 356-358 | 3 | |
| β-strand | 361-365 | 5 | 2 |
| β-strand | 368-372 | 5 | 2 |
| α-helix | 374-376 | 3 | |
| β-strand | 381-384 | 4 | 2 |
| α-helix | 388-407 | 20 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 211-226 | 16 | |
| α-helix | 234-249 | 16 | |
| α-helix | 264-266 | 3 | |
| α-helix | 270-272 | 3 | |
| α-helix | 278-288 | 11 | |
| α-helix | 294-307 | 14 | |
| β-strand | 314-321 | 8 | 3 |
| α-helix | 322 | 1 | |
| β-strand | 328-335 | 8 | 3 |
| β-strand | 339-343 | 5 | 3 |
| β-strand | 350-355 | 6 | 3 |
| α-helix | 356-358 | 3 | |
| β-strand | 361-364 | 4 | 3 |
| β-strand | 368-372 | 5 | 3 |
| α-helix | 374-376 | 3 | |
| β-strand | 381-384 | 4 | 3 |
| α-helix | 388-406 | 19 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 751-769 | 19 | |
| α-helix | 770-772 | 3 | |
| α-helix | 773 | 1 | |
| β-strand | 774-775 | 2 | 3 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 751-769 | 19 | |
| α-helix | 770-772 | 3 | |
| α-helix | 773 | 1 | |
| β-strand | 774-775 | 2 | 2 |
| α-helix | 786-788 | 3 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Talin-2 | A, B | protein | 223 | Mus musculus | Q71LX4 (AlphaFold model) |
| Integrin beta-1D | C, D | protein | 52 | Homo sapiens | P05556 (AlphaFold model) |
>3G9W_1 Talin-2 (chains A, B) GIDPFTGIDPFTKFFYSDQNVDSRDPVQLNLLYVQARDDILNGSHPVSFEKACEFGGFQA QIQFGPHVEHKHKPGFLDLKEFLPKEYIKQRGAEKRIFQEHKNCGEMSEIEAKVKYVKLA RSLRTYGVSFFLVKEKMKGKNKLVPRLLGITKDSVMRVDEKTKEVLQEWPLTTVKRWAAS PKSFTLDFGEYQESYYSVQTTEGEQISQLIAGYIDIILKKKQS
>3G9W_2 Integrin beta-1D (chains C, D) GPKLLMIIHDRREFAKFEKEKMNAKWDTQENPIYKSPINNFKNPNYGRKAGL
The structure of an integrin/talin complex reveals the basis of inside-out signal transduction. Anthis, N.J., Wegener, K.L., Ye, F. et al. EMBO J (2009) 28:3623-3632. DOI 10.1038/emboj.2009.287 · PubMed
MolViewer shows 3G9W directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.