3GL1: Heat shock protein SSB1

Name: PDB 3GL1: Crystal structure of ATPase domain of Ssb1 chaperone, a member of the HSP70 family, from Saccharomyces cerevisiae
Published: 2009-03-24
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: chaperone

Crystal structure of ATPase domain of Ssb1 chaperone, a member of the HSP70 family, from Saccharomyces cerevisiae. Determined by X-ray diffraction at 1.92 Å resolution. Released 24 Mar 2009.

Method: X-ray diffraction
Resolution: 1.92 Å
Organism: Saccharomyces cerevisiae
Chains: 2
Atoms: 6,667
Mol. weight: 84.61 kDa
Ligands: MG
Released: 24 Mar 2009

Explore 3GL1 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3GL1 contains 37 α-helices and 43 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 19 helices, 22 β-strands

Element	Residues	Length	Sheet
β-strand	5	1	1
β-strand	10-13	4	2
β-strand	18-19	2	3
β-strand	20-24	5	2
β-strand	28-30	3	2
α-helix	31-32	2
β-strand	40-41	2	3
β-strand	44-46	3	4
β-strand	51-53	3	4
α-helix	55-59	5
α-helix	61-63	3
α-helix	65-67	3
β-strand	68-69	2	4
α-helix	72-74	3
α-helix	83-89	7
β-strand	95-99	5	5
β-strand	102-109	8	5
β-strand	112-116	5	5
α-helix	118-137	20
β-strand	140	1	1
β-strand	143-148	6	2
α-helix	154-166	13
β-strand	170-176	7	2
α-helix	177-184	8
β-strand	196-203	8	6
β-strand	208-216	9	6
β-strand	219-228	10	6
α-helix	233-252	20
α-helix	260-276	17
β-strand	282-291	10	7
β-strand	294-301	8	7
α-helix	302-308	7
α-helix	310-315	6
α-helix	317-327	11
α-helix	331-333	3
β-strand	336-340	5	6
α-helix	342-345	4
α-helix	347-356	10
α-helix	360-362	3
β-strand	363	1	6
α-helix	371-383	13

Chain B: 18 helices, 21 β-strands

Element	Residues	Length	Sheet
β-strand	5	1	8
β-strand	9-14	6	9
β-strand	18-24	7	9
β-strand	28-30	3	9
β-strand	40-41	2	9
β-strand	44-46	3	10
β-strand	51-53	3	10
α-helix	55-58	4
α-helix	65-67	3
β-strand	68-69	2	10
α-helix	72-74	3
α-helix	83-89	7
β-strand	95-99	5	11
β-strand	102-109	8	11
β-strand	112-116	5	11
α-helix	118-137	20
β-strand	140	1	8
β-strand	143-148	6	9
α-helix	154-166	13
β-strand	170-176	7	9
α-helix	177-184	8
α-helix	189-191	3
β-strand	196-203	8	12
β-strand	208-216	9	12
β-strand	219-228	10	12
α-helix	233-252	20
α-helix	260-277	18
β-strand	282-291	10	13
β-strand	294-301	8	13
α-helix	302-308	7
α-helix	310-315	6
α-helix	317-327	11
α-helix	331-333	3
β-strand	336-340	5	12
α-helix	342-345	4
α-helix	347-356	10
α-helix	360-362	3
β-strand	363	1	12
α-helix	371-382	12

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Heat shock protein SSB1	A, B	protein	387	Saccharomyces cerevisiae	P11484 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>3GL1_1 Heat shock protein SSB1 (chains A, B)
SNAMAEGVFQGAIGIDLGTTYSCVATYESSVEIIANEQGNRVTPSFVAFTPEERLIGDAA
KNQAALNPRNTVFDAKRLIGRRFDDESVQKDMKTWPFKVIDVDGNPVIEVQYLEETKTFS
PQEISAMVLTKMKEIAEAKIGKKVEKAVITVPAYFNDAQRQATKDAGAISGLNVLRIINE
PTAAAIAYGLGAGKSEKERHVLIFDLGGGTFDVSLLHIAGGVYTVKSTSGNTHLGGQDFD
TNLLEHFKAEFKKKTGLDISDDARALRRLRTAAERAKRTLSSVTQTTVEVDSLFDGEDFE
SSLTRARFEDLNAALFKSTLEPVEQVLKDAKISKSQIDEVVLVGGSTRIPKVQKLLSDFF
DGKQLEKSINPDEAVAYGAAVQGAILT

Ligands and cofactors

ID	Name	Formula	Copies
MG	Magnesium ion	Mg	3

Water and common crystallization additives (GOL, CL) are not listed.

Primary citation

Crystal structure of ATPase domain of Ssb1 chaperone, member of the HSP70 family from Saccharomyces cerevisiae. Osipiuk, J., Li, H., Bargassa, M. et al. To be published.

Other PDB entries of the same protein (UniProt P11484 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9R9O 2.9 Å, Yeast 80S with nascent chain in complex with Ssb1-ADP in the S1 state
9R9P 3.0 Å, Yeast 80S with nascent chain in complex with Ssb1-ADP in the S2 state

Browse structure collections

About this viewer

MolViewer shows 3GL1 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.