Crystal structure of JARID1A-PHD3 complexed with H3(1-9)K4me3 peptide. Determined by X-ray diffraction at 1.9 Å resolution. Released 5 May 2009.
Explore 3GL6 in 3D Show helices and sheets RCSB PDB PDBe
3GL6 contains 2 α-helices and 3 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 1622-1627 | 6 | 1 |
| β-strand | 1635-1637 | 3 | 1 |
| α-helix | 1639-1641 | 3 | |
| α-helix | 1645-1650 | 6 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 3-7 | 5 | 1 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Histone demethylase JARID1A | A | protein | 52 | Homo sapiens | P29375 (AlphaFold model) |
| Histone H3 | B | protein | 9 | Homo sapiens | Q92133 (AlphaFold model) |
>3GL6_1 Histone demethylase JARID1A (chains A) SVCAAQNCQRPCKDKVDWVQCDGGCDEWFHQVCVGVSPEMAENEDYICINCA
>3GL6_2 Histone H3 (chains B) ARTKQTARK
| ID | Name | Formula | Copies |
|---|---|---|---|
| ZN | Zinc ion | Zn | 3 |
Haematopoietic malignancies caused by dysregulation of a chromatin-binding PHD finger. Wang, G.G., Song, J., Wang, Z. et al. Nature (2009) 459:847-851. DOI 10.1038/nature08036 · PubMed
Other PDB entries of the same protein (UniProt P29375 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 3GL6 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.