3GS3: Symplekin

Structure of the N-terminal HEAT Domain of Symplekin from D. melanogaster. Determined by X-ray diffraction at 2.4 Å resolution. Released 14 Jul 2009.

Method: X-ray diffraction
Resolution: 2.4 Å
Organism: Drosophila melanogaster
Chains: 1
Atoms: 2,059
Mol. weight: 28.31 kDa
Released: 14 Jul 2009

Explore 3GS3 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3GS3 contains 19 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 19 helices, 0 β-strands

Element	Residues	Length
α-helix	23-37	15
α-helix	42-54	13
α-helix	55-59	5
α-helix	61-63	3
α-helix	64-72	9
α-helix	73-76	4
α-helix	80-96	17
α-helix	98-100	3
α-helix	101-111	11
α-helix	117-138	22
α-helix	146-164	19
α-helix	165-167	3
α-helix	171-187	17
α-helix	196-197	2
α-helix	204-206	3
α-helix	216-234	19
α-helix	241-257	17
α-helix	259-261	3
α-helix	262-269	8

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Symplekin	A	protein	257	Drosophila melanogaster	Q8MSU4 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>3GS3_1 Symplekin (chains A)
NIGSGTDEKTATARAKVVDWCNELVIASPSTKCELLAKVQETVLGSCAELAEEFLESVLS
LAHDSNMEVRKQVVAFVEQVCKVKVELLPHVINVVSMLLRDNSAQVIKRVIQACGSIYKN
GLQYLCSLMEPGDSAEQAWNILSLIKAQILDMIDNENDGIRTNAIKFLEGVVVLQSFADE
DSLKRDGDFSLADVPDHCTLFRREKLQEEGNNILDILLQFHGTTHISSVNLIACTSSLCT
IAKMRPIFMGAVVEAFK

Primary citation

Crystal structure of the HEAT domain from the Pre-mRNA processing factor Symplekin. Kennedy, S.A., Frazier, M.L., Steiniger, M. et al. J Mol Biol (2009) 392:115-128. DOI 10.1016/j.jmb.2009.06.062 · PubMed

Other PDB entries of the same protein (UniProt Q8MSU4 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4IMI 2.35 Å, Novel Modifications on C-terminal Domain of RNA Polymerase II can Fine- tune the…
6NPW 2.49 Å, SSu72/Sympk in complex with Ser2/Ser5 phosphorylated peptide
4IMJ 2.58 Å, Novel Modifications on C-terminal Domain of RNA Polymerase II can Fine-tune the…
4YGX 2.95 Å, Crystal Structure of D. melanogaster Ssu72+Symplekin bound to cis peptidomimetic CTD…

Browse structure collections

About this viewer

MolViewer shows 3GS3 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.