3GV3: CXCL12 (SDF) in trigonal space group

CXCL12 (SDF) in trigonal space group. Determined by X-ray diffraction at 1.6 Å resolution. Released 26 Jan 2010.

Method: X-ray diffraction
Resolution: 1.6 Å
Organism: Homo sapiens
Chains: 1
Atoms: 556
Mol. weight: 7.45 kDa
Released: 26 Jan 2010

Explore 3GV3 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3GV3 contains 2 α-helices and 5 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 2 helices, 5 β-strands

Element	Residues	Length	Sheet
β-strand	15	1	1
α-helix	20-22	3
β-strand	23-28	6	2
β-strand	38-42	5	2
β-strand	48-50	3	2
β-strand	51	1	1
α-helix	58-65	8

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
CXCL12 protein	A	protein	63	Homo sapiens	P48061 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>3GV3_1 CXCL12 protein (chains A)
LSYRCPCRFFESHIARANVKHLKILNTPNCALQIVARLKNNNRQVCIDPKLKWIQEYLEK
ALN

Primary citation

Heterologous quaternary structure of CXCL12 and its relationship to the CC chemokine family. Murphy, J.W., Yuan, H., Kong, Y. et al. Proteins (2009) 78:1331-1337. DOI 10.1002/prot.22666 · PubMed

Other PDB entries of the same protein (UniProt P48061 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6SHR 1.75 Å, X-ray crystal structure of cell-free protein synthesis (CFPS) produced SDF1-a
4UAI 1.9 Å, Crystal structure of CXCL12 in complex with inhibitor
2J7Z 1.95 Å, Crystal Structure of recombinant Human Stromal Cell-Derived Factor- 1alpha
1QG7 2.0 Å, Stroma cell-derived factor-1ALPHA (sdf-1ALPHA)
2NWG 2.07 Å, Structure of CXCL12:heparin disaccharide complex
1A15 2.2 Å, Sdf-1ALPHA
3HP3 2.2 Å, Crystal structure of CXCL12
9UPV 2.7 Å, Cryo-EM structure of CXCR4 complexed with agonist SDVX1
4LMQ 2.77 Å, Development and Preclinical Characterization of a Humanized Antibody Targeting CXCL12
9UPU 2.8 Å, Cryo-EM strucutre of CXCR4 complexed with agonist SDV1a
8K3Z 2.81 Å, Cryo-EM structure of CXCR4 in complex with CXCL12
8U4O 3.29 Å, Structure of CXCL12-bound CXCR4/Gi complex

Browse structure collections

About this viewer

MolViewer shows 3GV3 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.