3GV6: Chromobox protein homolog 6

Crystal Structure of human chromobox homolog 6 (CBX6) with H3K9 peptide. Determined by X-ray diffraction at 1.76 Å resolution. Released 21 Apr 2009.

Method: X-ray diffraction
Resolution: 1.76 Å
Organisms: Homo sapiens, Xenopus laevis
Chains: 2
Atoms: 576
Mol. weight: 8.75 kDa
Released: 21 Apr 2009

Explore 3GV6 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3GV6 contains 3 α-helices and 6 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 3 helices, 5 β-strands

Element	Residues	Length	Sheet
β-strand	9-12	4	1
β-strand	13-22	10	2
β-strand	25-32	8	2
α-helix	37-39	3
β-strand	41-44	4	2
α-helix	45-47	3
β-strand	48	1	1
α-helix	51-62	12

Chain B: 0 helices, 1 β-strand

Element	Residues	Length	Sheet
β-strand	6-9	4	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Chromobox protein homolog 6	A	protein	58	Homo sapiens	O95503 (AlphaFold model)
Histone H3K9me3 peptide	B	protein	15	Xenopus laevis	P84233 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>3GV6_1 Chromobox protein homolog 6 (chains A)
ERVFAAESIIKRRIRKGRIEYLVKWKGWAIKYSTWEPEENILDSRLIAAFEQKERERE

Sequence of entity 2 (B), FASTA

>3GV6_2 Histone H3K9me3 peptide (chains B)
ARTKQTARKSTGGKA

Primary citation

Recognition and specificity determinants of the human cbx chromodomains. Kaustov, L., Ouyang, H., Amaya, M. et al. J Biol Chem (2011) 286:521-529. DOI 10.1074/jbc.M110.191411 · PubMed

Other PDB entries of the same protein (UniProt O95503 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3I90 2.0 Å, Crystal structure of human chromobox homolog 6 (CBX6) with H3K27 peptide

Browse structure collections

About this viewer

MolViewer shows 3GV6 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.