Catalytic domain of human phosphodiesterase 4B2B in complex with a quinoline inhibitor. Determined by X-ray diffraction at 1.75 Å resolution. Released 7 Apr 2010.
Explore 3GWT in 3D Show helices and sheets RCSB PDB PDBe
3GWT contains 24 α-helices and 2 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 160-170 | 11 | |
| α-helix | 180-186 | 7 | |
| α-helix | 191-202 | 12 | |
| α-helix | 205-209 | 5 | |
| α-helix | 213-225 | 13 | |
| α-helix | 236-250 | 15 | |
| α-helix | 253-255 | 3 | |
| α-helix | 261-273 | 13 | |
| α-helix | 283-288 | 6 | |
| α-helix | 292-297 | 6 | |
| α-helix | 302-313 | 12 | |
| α-helix | 318-320 | 3 | |
| α-helix | 328-343 | 16 | |
| α-helix | 347-349 | 3 | |
| α-helix | 350-362 | 13 | |
| β-strand | 366 | 1 | 1 |
| β-strand | 372 | 1 | 1 |
| α-helix | 377-392 | 16 | |
| α-helix | 395-397 | 3 | |
| α-helix | 400-423 | 24 | |
| α-helix | 426-429 | 4 | |
| α-helix | 430-432 | 3 | |
| α-helix | 439-446 | 8 | |
| α-helix | 447-451 | 5 | |
| α-helix | 452-462 | 11 | |
| α-helix | 467-481 | 15 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| cAMP-specific 3',5'-cyclic phosphodiesterase 4B | A | protein | 353 | Homo sapiens | Q07343 (AlphaFold model) |
>3GWT_1 cAMP-specific 3',5'-cyclic phosphodiesterase 4B (chains A) MSISRFGVNTENEDHLAKELEDLNKWGLNIFNVAGYSHNRPLTCIMYAIFQERDLLKTFR ISSDTFITYMMTLEDHYHSDVAYHNSLHAADVAQSTHVLLSTPALDAVFTDLEILAAIFA AAIHDVDHPGVSNQFLINTNSELALMYNDESVLENHHLAVGFKLLQEEHCDIFMNLTKKQ RQTLRKMVIDMVLATDMSKHMSLLADLKTMVETKKVTSSGVLLLDNYTDRIQVLRNMVHC ADLSNPTKSLELYRQWTDRIMEEFFQQGDKERERGMEISPMCDKHTASVEKSQVGFIDYI VHPLWETWADLVQPDAQDILDTLEDNRNWYQAMIPQAPAPPLDEQNRDCQGLM
| ID | Name | Formula | Copies |
|---|---|---|---|
| ARS | Arsenic | As | 4 |
| MG | Magnesium ion | Mg | 1 |
| ZN | Zinc ion | Zn | 1 |
| 066 | 6-{[3-(dimethylcarbamoyl)phenyl]sulfonyl}-4-[(3-methoxyphenyl)amino]-8-methylqu… | C27 H26 N4 O5 S | 1 |
Water and common crystallization additives (GOL) are not listed.
Quinolines as a novel structural class of potent and selective PDE4 inhibitors. Optimisation for inhaled administration. Woodrow, M.D., Ballantine, S.P., Barker, M.D. et al. Bioorg Med Chem Lett (2009) 19:5261-5265. DOI 10.1016/j.bmcl.2009.04.012 · PubMed
Other PDB entries of the same protein (UniProt Q07343 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 3GWT directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.