Crystal structure of acid-alpha-galactosidase A complexed with galactose at pH 4.5. Determined by X-ray diffraction at 2.2 Å resolution. Released 5 May 2009.
Explore 3GXP in 3D Show helices and sheets RCSB PDB PDBe
3GXP contains 33 α-helices and 47 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 42-45 | 4 | 1 |
| α-helix | 47-50 | 4 | |
| α-helix | 66-78 | 13 | |
| β-strand | 88-90 | 3 | 1 |
| β-strand | 96 | 1 | 2 |
| β-strand | 108 | 1 | 2 |
| α-helix | 116-126 | 11 | |
| β-strand | 130-136 | 7 | 1 |
| β-strand | 140 | 1 | 3 |
| β-strand | 146 | 1 | 3 |
| α-helix | 147 | 1 | |
| α-helix | 152-162 | 11 | |
| β-strand | 166-170 | 5 | 1 |
| α-helix | 177-194 | 18 | |
| β-strand | 199-202 | 4 | 1 |
| α-helix | 204-208 | 5 | |
| α-helix | 216-222 | 7 | |
| β-strand | 225-227 | 3 | 1 |
| α-helix | 236-248 | 13 | |
| α-helix | 250-253 | 4 | |
| β-strand | 258 | 1 | 4 |
| β-strand | 261 | 1 | 4 |
| β-strand | 262-264 | 3 | 1 |
| β-strand | 268 | 1 | 1 |
| α-helix | 277-289 | 13 | |
| β-strand | 294-296 | 3 | 1 |
| α-helix | 305-311 | 7 | |
| α-helix | 314-320 | 7 | |
| β-strand | 329-334 | 6 | 5 |
| β-strand | 337-343 | 7 | 5 |
| α-helix | 345-347 | 3 | |
| β-strand | 348-355 | 8 | 5 |
| β-strand | 363-368 | 6 | 6 |
| α-helix | 369-371 | 3 | |
| α-helix | 373-375 | 3 | |
| β-strand | 381-388 | 8 | 5 |
| β-strand | 392-398 | 7 | 5 |
| β-strand | 402-407 | 6 | 6 |
| β-strand | 409 | 1 | 5 |
| β-strand | 412-419 | 8 | 5 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 42-45 | 4 | 7 |
| α-helix | 47-50 | 4 | |
| α-helix | 66-78 | 13 | |
| α-helix | 81-84 | 4 | |
| β-strand | 88-90 | 3 | 7 |
| β-strand | 96 | 1 | 8 |
| β-strand | 108 | 1 | 8 |
| α-helix | 116-126 | 11 | |
| β-strand | 130-136 | 7 | 7 |
| β-strand | 140 | 1 | 9 |
| β-strand | 146 | 1 | 9 |
| α-helix | 152-162 | 11 | |
| β-strand | 166-170 | 5 | 7 |
| α-helix | 177-192 | 16 | |
| β-strand | 199-202 | 4 | 7 |
| α-helix | 204-208 | 5 | |
| α-helix | 216-220 | 5 | |
| β-strand | 225-227 | 3 | 7 |
| α-helix | 230-232 | 3 | |
| α-helix | 236-248 | 13 | |
| α-helix | 250-253 | 4 | |
| β-strand | 258 | 1 | 10 |
| β-strand | 261 | 1 | 10 |
| β-strand | 262-264 | 3 | 7 |
| β-strand | 268 | 1 | 7 |
| α-helix | 277-289 | 13 | |
| β-strand | 294-296 | 3 | 7 |
| α-helix | 305-311 | 7 | |
| α-helix | 314-320 | 7 | |
| β-strand | 329-334 | 6 | 11 |
| β-strand | 337-343 | 7 | 11 |
| α-helix | 345-347 | 3 | |
| β-strand | 349-355 | 7 | 11 |
| β-strand | 363-368 | 6 | 12 |
| α-helix | 369-371 | 3 | |
| α-helix | 373-375 | 3 | |
| β-strand | 381-388 | 8 | 11 |
| β-strand | 392-398 | 7 | 11 |
| β-strand | 402-407 | 6 | 12 |
| β-strand | 412-419 | 8 | 11 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Alpha-galactosidase A | A, B | protein | 398 | Homo sapiens | P06280 (AlphaFold model) |
>3GXP_1 Alpha-galactosidase A (chains A, B) LDNGLARTPTMGWLHWERFMCNLDCQEEPDSCISEKLFMEMAELMVSEGWKDAGYEYLCI DDCWMAPQRDSEGRLQADPQRFPHGIRQLANYVHSKGLKLGIYADVGNKTCAGFPGSFGY YDIDAQTFADWGVDLLKFDGCYCDSLENLADGYKHMSLALNRTGRSIVYSCEWPLYMWPF QKPNYTEIRQYCNHWRNFADIDDSWKSIKSILDWTSFNQERIVDVAGPGGWNDPDMLVIG NFGLSWNQQVTQMALWAIMAAPLFMSNDLRHISPQAKALLQDKDVIAINQDPLGKQGYQL RQGDNFEVWERPLSGLAWAVAMINRQEIGGPRSYTIAVASLGKGVACNPACFITQLLPVK RKLGFYEWTSRLRSHINPTGTVLLQLENTMQMSLKDLL
| ID | Name | Formula | Copies |
|---|---|---|---|
| GLA | alpha-D-galactopyranose | C6 H12 O6 | 2 |
| TAM | Tris(hydroxyethyl)aminomethane | C7 H17 N O3 | 1 |
| NAG | 2-acetamido-2-deoxy-beta-D-glucopyranose | C8 H15 N O6 | 2 |
| MAN | alpha-D-mannopyranose | C6 H12 O6 | 2 |
Water and common crystallization additives (SO4) are not listed.
Effects of pH and iminosugar pharmacological chaperones on lysosomal glycosidase structure and stability. Lieberman, R.L., D'aquino, J.A., Ringe, D. et al. Biochemistry (2009) 48:4816-4827. DOI 10.1021/bi9002265 · PubMed
Other PDB entries of the same protein (UniProt P06280 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 3GXP directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.