3H1Z: AP-2 complex subunit beta-1

Molecular basis for the association of PIPKIgamma -p90 with the clathrin adaptor AP-2. Determined by X-ray diffraction at 1.83 Å resolution. Released 24 Nov 2009.

Method: X-ray diffraction
Resolution: 1.83 Å
Organism: Rattus norvegicus
Chains: 2
Atoms: 2,270
Mol. weight: 31.15 kDa
Released: 24 Nov 2009

Explore 3H1Z in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3H1Z contains 11 α-helices and 20 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 9 helices, 19 β-strands

Element	Residues	Length	Sheet
α-helix	709-711	3
β-strand	712-715	4	1
α-helix	717-719	3
β-strand	723-732	10	1
β-strand	735-744	10	1
β-strand	750	1	2
β-strand	754-757	4	3
β-strand	760	1	4
β-strand	765-766	2	1
β-strand	776	1	2
β-strand	781-789	9	1
β-strand	794	1	4
β-strand	802-808	7	3
β-strand	813-819	7	3
α-helix	820-821	2
α-helix	822-825	4
β-strand	826	1	5
α-helix	834-843	10
α-helix	846-848	3
β-strand	850-854	5	6
α-helix	861-870	10
β-strand	874-881	8	6
β-strand	884-892	9	6
β-strand	893	1	5
β-strand	898-905	8	6
β-strand	912-917	6	6
α-helix	921-923	3
α-helix	924-935	12

Chain P: 2 helices, 1 β-strand

Element	Residues	Length	Sheet
α-helix	6-8	3
β-strand	10-11	2	3
α-helix	12-13	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
AP-2 complex subunit beta-1	A	protein	260	Rattus norvegicus	P62944 (AlphaFold model)
Phosphatidylinositol-4-phosphate 5-kinase type-1 gamma	P	protein	15		O60331 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>3H1Z_1 AP-2 complex subunit beta-1 (chains A)
MGSSHHHHHHSSGLVPRGSHMASGMAPGGYVAPKAVWLPAVKAKGLEISGTFTHRQGHIY
MEMNFTNKALQHMTDFAIQFNKNSFGVIPSTPLAIHTPLMPNQSIDVSLPLNTLGPVMKM
EPLNNLQVAVKNNIDVFYFSCLIPLNVLFVEDGKMERQVFLATWKDIPNENELQFQIKEC
HLNADTVSSKLQNNNVYTIAKRNVEGQDMLYQSLKLTNGIWILAELRIQPGNPNYTLSLK
CRAPEVSQYIYQVYDSILKN

Sequence of entity 2 (P), FASTA

>3H1Z_2 Phosphatidylinositol-4-phosphate 5-kinase type-1 gamma (chains P)
YFPTDERSWVYSPLH

Primary citation

Molecular basis for association of PIPKI gamma-p90 with clathrin adaptor AP-2. Kahlfeldt, N., Vahedi-Faridi, A., Koo, S.J. et al. J Biol Chem (2010) 285:2734-2749. DOI 10.1074/jbc.M109.074906 · PubMed

Other PDB entries of the same protein (UniProt P62944 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3HS9 2.15 Å, Intersectin 1-peptide-AP2 beta ear complex
6OWT 3.8 Å, Structure of SIVsmm Nef and SMM tetherin bound to the clathrin adaptor AP-2 complex

Browse structure collections

About this viewer

MolViewer shows 3H1Z directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.