Structure of Alk5 + GW855857. Determined by X-ray diffraction at 1.7 Å resolution. Released 23 Jun 2009.
Explore 3HMM in 3D Show helices and sheets RCSB PDB PDBe
3HMM contains 17 α-helices and 19 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 2-4 | 3 | |
| β-strand | 5-13 | 9 | 1 |
| β-strand | 18-24 | 7 | 1 |
| β-strand | 27-34 | 8 | 1 |
| α-helix | 36-38 | 3 | |
| α-helix | 39-49 | 11 | |
| β-strand | 59 | 1 | 2 |
| β-strand | 62-69 | 8 | 1 |
| β-strand | 74-81 | 8 | 1 |
| β-strand | 87 | 1 | 2 |
| α-helix | 88-94 | 7 | |
| β-strand | 97 | 1 | 3 |
| α-helix | 99-117 | 19 | |
| β-strand | 120 | 1 | 4 |
| β-strand | 126 | 1 | 4 |
| β-strand | 129-130 | 2 | 5 |
| α-helix | 136-138 | 3 | |
| β-strand | 139-141 | 3 | 2 |
| β-strand | 147-149 | 3 | 2 |
| β-strand | 156-157 | 2 | 5 |
| β-strand | 158-159 | 2 | 6 |
| β-strand | 164-165 | 2 | 6 |
| α-helix | 176-178 | 3 | |
| α-helix | 181-184 | 4 | |
| α-helix | 193-213 | 21 | |
| β-strand | 215 | 1 | 3 |
| β-strand | 217 | 1 | 7 |
| β-strand | 220 | 1 | 7 |
| α-helix | 222-224 | 3 | |
| α-helix | 238-242 | 5 | |
| α-helix | 243-247 | 5 | |
| α-helix | 256-259 | 4 | |
| α-helix | 262-272 | 11 | |
| α-helix | 279-281 | 3 | |
| α-helix | 283-284 | 2 | |
| α-helix | 285-297 | 13 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| TGF-beta receptor type-1 | A | protein | 303 | Homo sapiens | P36897 (AlphaFold model) |
>3HMM_1 TGF-beta receptor type-1 (chains A) IARTIVLQESIGKGRFGEVWRGKWRGEEVAVKIFSSREERSWFREAEIYQTVMLRHENIL GFIAADNKDNGTWTQLWLVSDYHEHGSLFDYLNRYTVTVEGMIKLALSTASGLAHLHMEI VGTQGKPAIAHRDLKSKNILVKKNGTCCIADLGLAVRHDSATDTIDIAPNHRVGTKRYMA PEVLDDSINMKHFESFKRADIYAMGLVFWEIARRCSIGGIHEDYQLPYYDLVPSDPSVEE MRKVVCEQKLRPNIPNRWQSCEALRVMAKIMRECWYANGAARLTALRIKKTLSQLSQQEG IKM
| ID | Name | Formula | Copies |
|---|---|---|---|
| 855 | 2-(6-methylpyridin-2-yl)-N-pyridin-4-ylquinazolin-4-amine | C19 H15 N5 | 1 |
Design of novel quinazoline derivatives and related analogues as potent and selective ALK5 inhibitors. Gellibert, F., Fouchet, M.-H., Nguyen, V.-L. et al. Bioorg Med Chem Lett (2009) 19:2277-2281. DOI 10.1016/j.bmcl.2009.02.087 · PubMed
Other PDB entries of the same protein (UniProt P36897 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 3HMM directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.