3HQ5: Progesterone Receptor

Progesterone Receptor bound to an Alkylpyrrolidine ligand. Determined by X-ray diffraction at 2.1 Å resolution. Released 2 Mar 2010.

Method: X-ray diffraction
Resolution: 2.1 Å
Organism: Homo sapiens
Chains: 2
Atoms: 4,543
Mol. weight: 60.47 kDa
Ligands: GKK
Released: 2 Mar 2010

Explore 3HQ5 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3HQ5 contains 23 α-helices and 8 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 13 helices, 4 β-strands

Element	Residues	Length	Sheet
α-helix	686-693	8
α-helix	695-698	4
α-helix	711-733	23
α-helix	739-741	3
α-helix	744-753	10
α-helix	755-771	17
β-strand	776-779	4	1
β-strand	782-784	3	1
α-helix	793-801	9
α-helix	803-811	9
α-helix	815-826	12
β-strand	829-831	3	2
α-helix	838-857	20
α-helix	865-896	32
α-helix	898-901	4
α-helix	907-921	15
β-strand	925-927	3	2

Chain B: 10 helices, 4 β-strands

Element	Residues	Length	Sheet
α-helix	686-693	8
α-helix	711-735	25
α-helix	739-741	3
α-helix	744-771	28
β-strand	776-779	4	3
β-strand	782-784	3	3
α-helix	786-790	5
α-helix	795-811	17
α-helix	815-826	12
β-strand	829-830	2	4
α-helix	838-857	20
α-helix	863-896	34
α-helix	907-921	15
β-strand	926-927	2	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Progesterone receptor	A, B	protein	256	Homo sapiens	P06401 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>3HQ5_1 Progesterone receptor (chains A, B)
GQDIQLIPPLINLLMSIEPDVIYAGHDNTKPDTSSSLLTSLNQLGERQLLSVVKWSKSLP
GFRNLHIDDQITLIQYSWMSLMVFGLGWRSYKHVSGQMLYFAPDLILNEQRMKESSFYSL
CLTMWQIPQEFVKLQVSQEEFLCMKVLLLLNTIPLEGLRSQTQFEEMRSSYIRELIKAIG
LRQKGVVSSSQRFYQLTKLLDNLHDLVKQLHLYCLNTFIQSRALSVEFPEMMSEVIAAQL
PKILAGMVKPLLFHKK

Ligands and cofactors

ID	Name	Formula	Copies
GKK	2-chloro-4-{[(3S)-1-methylpyrrolidin-3-yl][2-(trifluoromethyl)benzyl]amino}benz…	C20 H19 Cl F3 N3	2

Water and common crystallization additives (GOL, SO4) are not listed.

Primary citation

Rational design of orally-active, pyrrolidine-based progesterone receptor partial agonists. Thompson, S.K., Washburn, D.G., Frazee, J.S. et al. Bioorg Med Chem Lett (2009) 19:4777-4780. DOI 10.1016/j.bmcl.2009.06.055 · PubMed

Other PDB entries of the same protein (UniProt P06401 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1SQN 1.45 Å, Progesterone Receptor Ligand Binding Domain with bound Norethindrone
1SR7 1.46 Å, Progesterone Receptor Hormone Binding Domain with Bound Mometasone Furoate
3ZR7 1.65 Å, Structural basis for agonism and antagonism for a set of chemically related progesterone…
1A28 1.8 Å, Hormone-bound human progesterone receptor ligand-binding domain
2W8Y 1.8 Å, RU486 bound to the progesterone receptor in a destabilized agonistic conformation
3ZRB 1.8 Å, Structural basis for agonism and antagonism for a set of chemically related progesterone…
3G8O 1.9 Å, Progesterone Receptor with bound Pyrrolidine 1
3ZRA 1.9 Å, Structural basis for agonism and antagonism for a set of chemically related progesterone…
4APU 1.9 Å, PR X-Ray structures in agonist conformations reveal two different mechanisms for partial…
1ZUC 2.0 Å, Progesterone receptor ligand binding domain in complex with the nonsteroidal agonist…
2OVH 2.0 Å, Progesterone Receptor with Bound Asoprisnil and a Peptide from the Co-Repressor SMRT
3KBA 2.0 Å, Progesterone receptor bound to sulfonamide pyrrolidine partial agonist

Browse structure collections

About this viewer

MolViewer shows 3HQ5 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.