Crystal structure of human desarg-C5A. Determined by X-ray diffraction at 2.59 Å resolution. Released 2 Feb 2010.
Explore 3HQA in 3D Show helices and sheets RCSB PDB PDBe
3HQA contains 7 α-helices and 0 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 3-13 | 11 | |
| α-helix | 16-26 | 11 | |
| α-helix | 34-39 | 6 | |
| α-helix | 45-64 | 20 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 4-26 | 23 | |
| α-helix | 34-39 | 6 | |
| α-helix | 45-64 | 20 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Complement C5 | A, B | protein | 73 | Homo sapiens | P01031 (AlphaFold model) |
>3HQA_1 Complement C5 (chains A, B) MLQKKIEEIAAKYKHSVVKKCCYDGACVNNDETCEQRAARISLGPRCIKAFTECCVVASQ LRANISHKDMQLG
Structure of human desArg-C5a. Cook, W.J., Galakatos, N., Boyar, W.C. et al. Acta Crystallogr D Biol Crystallogr (2010) 66:190-197. DOI 10.1107/S0907444909049051 · PubMed
Other PDB entries of the same protein (UniProt P01031 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 3HQA directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.