3HSV: Speckle-type POZ protein

Structures of SPOP-Substrate Complexes: Insights into Molecular Architectures of BTB-Cul3 Ubiquitin Ligases: SPOPMATHx-MacroH2ASBCpep2. Determined by X-ray diffraction at 1.43 Å resolution. Released 20 Oct 2009.

Method: X-ray diffraction
Resolution: 1.43 Å
Organism: Homo sapiens
Chains: 3
Atoms: 2,740
Mol. weight: 34.8 kDa
Ligands: ZN
Released: 20 Oct 2009

Explore 3HSV in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3HSV contains 11 α-helices and 21 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 5 helices, 10 β-strands

Element	Residues	Length	Sheet
β-strand	29-38	10	1
β-strand	52-53	2	2
α-helix	54-56	3
β-strand	57	1	2
β-strand	67-72	6	2
α-helix	78-80	3
β-strand	83-90	8	2
β-strand	98-107	10	1
β-strand	113-118	6	1
β-strand	123-125	3	1
β-strand	130-138	9	2
α-helix	139-142	4
α-helix	145-147	3
α-helix	151-153	3
β-strand	155-164	10	1

Chain B: 6 helices, 10 β-strands

Element	Residues	Length	Sheet
β-strand	30-38	9	3
α-helix	41-43	3
β-strand	52-53	2	4
α-helix	54-56	3
β-strand	57	1	4
β-strand	66-72	7	4
α-helix	78-80	3
β-strand	83-92	10	4
β-strand	98-107	10	3
β-strand	113-118	6	3
β-strand	123-125	3	3
β-strand	130-138	9	4
α-helix	139-142	4
α-helix	145-147	3
α-helix	151-153	3
β-strand	155-163	9	3

Chain M: 0 helices, 1 β-strand

Element	Residues	Length	Sheet
β-strand	180	1	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Speckle-type POZ protein	A, B	protein	145	Homo sapiens	Q5NVK7 (AlphaFold model)
Core histone macro-H2A.1	M	protein	16	Homo sapiens	O75367 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>3HSV_1 Speckle-type POZ protein (chains A, B)
GSGGSGKVVKFSYMWTINNFSFCREEMGEVIKSSTFSSGANDKLKWCLRVNPKGLDEESK
DYLSLYLLLVSCPKSEVRAKFKFSILNAKGEETKAMESQRAYRFVQGKDWGFKKFIRRGF
LLDEANGLLPDDKLTLFCEVSVVQD

Sequence of entity 2 (M), FASTA

>3HSV_2 Core histone macro-H2A.1 (chains M)
XDSTTEGTPADGFTVL

Ligands and cofactors

ID	Name	Formula	Copies
ZN	Zinc ion	Zn	3

Water and common crystallization additives (SO4) are not listed.

Primary citation

Structures of SPOP-substrate complexes: insights into molecular architectures of BTB-Cul3 ubiquitin ligases. Zhuang, M., Calabrese, M.F., Liu, J. et al. Mol Cell (2009) 36:39-50. DOI 10.1016/j.molcel.2009.09.022 · PubMed

Browse structure collections

About this viewer

MolViewer shows 3HSV directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.