3I3N: BTB-BACK domains of human KLHL11

Crystal structure of the BTB-BACK domains of human KLHL11. Determined by X-ray diffraction at 2.6 Å resolution. Released 4 Aug 2009.

Method: X-ray diffraction
Resolution: 2.6 Å
Organism: Homo sapiens
Chains: 2
Atoms: 4,450
Mol. weight: 65.71 kDa
Ligands: SCN
Released: 4 Aug 2009

Explore 3I3N in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3I3N contains 40 α-helices and 10 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 20 helices, 5 β-strands

Element	Residues	Length	Sheet
β-strand	68-72	5	1
α-helix	76-90	15
β-strand	96-99	4	2
β-strand	107-110	4	2
α-helix	112-118	7
α-helix	123-125	3
β-strand	137-139	3	2
α-helix	140-142	3
α-helix	151-163	13
β-strand	165-169	5	3
α-helix	173-182	10
α-helix	186-199	14
α-helix	205-214	10
α-helix	218-230	13
α-helix	232-235	4
α-helix	240-243	4
α-helix	246-253	8
α-helix	263-275	13
α-helix	278-281	4
α-helix	285-289	5
α-helix	294-296	3
α-helix	299-301	3
α-helix	302-306	5
α-helix	310-313	4
α-helix	316-331	16

Chain B: 20 helices, 5 β-strands

Element	Residues	Length	Sheet
β-strand	68-72	5	3
α-helix	76-89	14
β-strand	96-99	4	4
β-strand	107-110	4	4
α-helix	112-118	7
α-helix	123-125	3
β-strand	137-139	3	4
α-helix	140-142	3
α-helix	151-163	13
β-strand	165-169	5	1
α-helix	173-182	10
α-helix	186-199	14
α-helix	205-214	10
α-helix	218-230	13
α-helix	232-235	4
α-helix	241-243	3
α-helix	246-253	8
α-helix	263-275	13
α-helix	278-281	4
α-helix	285-289	5
α-helix	294-296	3
α-helix	299-301	3
α-helix	302-306	5
α-helix	310-313	4
α-helix	316-331	16

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Kelch-like protein 11	A, B	protein	279	Homo sapiens	Q9NVR0 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>3I3N_1 Kelch-like protein 11 (chains A, B)
YFQSMEAEDFECSSHCSELSWRQNEQRRQGLFCDITLCFGGAGGREFRAHRSVLAAATEY
FTPLLSGQFSESRSGRVEMRKWSSEPGPEPDTVEAVIEYMYTGRIRVSTGSVHEVLELAD
RFLLIRLKEFCGEFLKKKLHLSNCVAIHSLAHMYTLSQLALKAADMIRRNFHKVIQDEEF
YTLPFHLIRDWLSDLEITVDSEEVLFETVLKWVQRNAEERERYFEELFKLLRLSQMKPTY
LTRHVKPERLVANNEVCVKLVADAVERHALRAENIQSGT

Ligands and cofactors

ID	Name	Formula	Copies
SCN	Thiocyanate ion	C N S	1

Water and common crystallization additives (CL) are not listed.

Primary citation

Crystal structure of the BTB-BACK domains of human KLHL11. Murray, J.W., Cooper, C.D.O., Krojer, T. et al. To be published.

Other PDB entries of the same protein (UniProt Q9NVR0 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4AP2 2.8 Å, Crystal structure of the human KLHL11-Cul3 complex at 2.8A resolution
4APF 3.1 Å, Crystal structure of the human KLHL11-Cul3 complex at 3.1A resolution

Browse structure collections

About this viewer

MolViewer shows 3I3N directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.