Interction of plakoglobin and beta-catenin with desmosomal cadherins. Determined by X-ray diffraction at 2.8 Å resolution. Released 15 Sept 2009.
Explore 3IFQ in 3D Show helices and sheets RCSB PDB PDBe
3IFQ contains 99 α-helices and 4 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 127-131 | 5 | |
| α-helix | 133-142 | 10 | |
| α-helix | 144-151 | 8 | |
| α-helix | 156-169 | 14 | |
| α-helix | 173-180 | 8 | |
| α-helix | 183-193 | 11 | |
| α-helix | 199-212 | 14 | |
| α-helix | 216-224 | 9 | |
| α-helix | 227-233 | 7 | |
| α-helix | 234-236 | 3 | |
| α-helix | 240-256 | 17 | |
| α-helix | 260-266 | 7 | |
| α-helix | 269-272 | 4 | |
| α-helix | 274-278 | 5 | |
| α-helix | 282-296 | 15 | |
| α-helix | 300-308 | 9 | |
| α-helix | 311-321 | 11 | |
| α-helix | 325-338 | 14 | |
| α-helix | 344-350 | 7 | |
| α-helix | 353-358 | 6 | |
| α-helix | 359-362 | 4 | |
| α-helix | 366-380 | 15 | |
| α-helix | 390-397 | 8 | |
| α-helix | 405-418 | 14 | |
| α-helix | 423-429 | 7 | |
| α-helix | 434-445 | 12 | |
| α-helix | 449-462 | 14 | |
| α-helix | 469-477 | 9 | |
| α-helix | 481-487 | 7 | |
| α-helix | 488-490 | 3 | |
| α-helix | 495-508 | 14 | |
| α-helix | 512-514 | 3 | |
| α-helix | 515-520 | 6 | |
| α-helix | 523-543 | 21 | |
| α-helix | 556-570 | 15 | |
| α-helix | 574-582 | 9 | |
| α-helix | 586-592 | 7 | |
| α-helix | 598-611 | 14 | |
| α-helix | 615-623 | 9 | |
| α-helix | 627-633 | 7 | |
| α-helix | 639-651 | 13 | |
| α-helix | 662-667 | 6 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 127-131 | 5 | |
| α-helix | 133-141 | 9 | |
| α-helix | 144-152 | 9 | |
| α-helix | 156-169 | 14 | |
| α-helix | 173-181 | 9 | |
| α-helix | 183-193 | 11 | |
| α-helix | 199-212 | 14 | |
| α-helix | 216-224 | 9 | |
| α-helix | 227-233 | 7 | |
| α-helix | 240-255 | 16 | |
| α-helix | 261-266 | 6 | |
| α-helix | 269-273 | 5 | |
| α-helix | 274-276 | 3 | |
| α-helix | 282-296 | 15 | |
| α-helix | 300-308 | 9 | |
| α-helix | 311-321 | 11 | |
| α-helix | 325-338 | 14 | |
| α-helix | 344-350 | 7 | |
| α-helix | 353-358 | 6 | |
| α-helix | 359-362 | 4 | |
| α-helix | 366-379 | 14 | |
| α-helix | 390-398 | 9 | |
| α-helix | 405-418 | 14 | |
| α-helix | 423-430 | 8 | |
| α-helix | 434-445 | 12 | |
| α-helix | 452-462 | 11 | |
| α-helix | 469-478 | 10 | |
| α-helix | 481-487 | 7 | |
| α-helix | 488-490 | 3 | |
| α-helix | 495-510 | 16 | |
| α-helix | 512-514 | 3 | |
| α-helix | 515-520 | 6 | |
| α-helix | 523-540 | 18 | |
| α-helix | 556-570 | 15 | |
| α-helix | 574-582 | 9 | |
| α-helix | 586-592 | 7 | |
| α-helix | 598-611 | 14 | |
| α-helix | 615-623 | 9 | |
| α-helix | 627-633 | 7 | |
| α-helix | 639-651 | 13 | |
| α-helix | 663-669 | 7 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 629-633 | 5 | 1 |
| α-helix | 639-641 | 3 | |
| α-helix | 643-646 | 4 | |
| α-helix | 653-664 | 12 | |
| α-helix | 672 | 1 | |
| β-strand | 674-678 | 5 | 1 |
| α-helix | 691-693 | 3 | |
| α-helix | 706-710 | 5 | |
| α-helix | 713-715 | 3 | |
| α-helix | 716-719 | 4 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 629-633 | 5 | 2 |
| α-helix | 634-635 | 2 | |
| α-helix | 640-647 | 8 | |
| α-helix | 650-652 | 3 | |
| α-helix | 653-664 | 12 | |
| α-helix | 672-673 | 2 | |
| β-strand | 674-678 | 5 | 2 |
| α-helix | 691-693 | 3 | |
| α-helix | 706-710 | 5 | |
| α-helix | 716-720 | 5 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| plakoglobin | A, B | protein | 553 | Homo sapiens | P14923 (AlphaFold model) |
| E-cadherin | C, D | protein | 107 | Mus musculus | P09803 (AlphaFold model) |
>3IFQ_1 plakoglobin (chains A, B) KSAIVHLINYQDDAELATRALPELTKLLNDEDPVVVTKAAMIVNQLSKKEASRRALMGSP QLVAAVVRTMQNTSDLDTARCTTSILHNLSHHREGLLAIFKSGGIPALVRMLSSPVESVL FYAITTLHNLLLYQEGAKMAVRLADGLQKMVPLLNKNNPKFLAITTDCLQLLAYGNQESK LIILANGGPQALVQIMRNYSYEKLLWTTSRVLKVLSVCPSNKPAIVEAGGMQALGKHLTS NSPRLVQNCLWTLRNLSDVATKQEGLESVLKILVNQLSVDDVNVLTCATGTLSNLTCNNS KNKTLVTQNSGVEALIHAILRAGDKDDITEPAVCALRHLTSRHPEAEMAQNSVRLNYGIP AIVKLLNQPNQWPLVKATIGLIRNLALCPANHAPLQEAAVIPRLVQLLVKAHQDAQRHVA AGTQQPYTDGVRMEEIVEGCTGALHILARDPMNRMEIFRLNTIPLFVQLLYSSVENIQRV AAGVLCELAQDKEAADAIDAEGASAPLMELLHSRNEGTATYAAAVLFRISEDKNPDYRKR VSVELTNSLFKHD
>3IFQ_2 E-cadherin (chains C, D) LDARPEVTRNDVAPTLMSVPQYRPRPANPDEIGNFIDENLKAADSDPTAPPYDSLLVFDY EGSGSEAASLSSLNSSESDQDQDYDYLNEWGNRFKKLADMYGGGEDD
Interactions of plakoglobin and beta-catenin with desmosomal cadherins: basis of selective exclusion of alpha- and beta-catenin from desmosomes. Choi, H.J., Gross, J.C., Pokutta, S. et al. J Biol Chem (2009) 284:31776-31788. DOI 10.1074/jbc.M109.047928 · PubMed
Other PDB entries of the same protein (UniProt P14923 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 3IFQ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.