3IZP: Conformation of EF-G during translocation

Conformation of EF-G during translocation. Determined by electron microscopy. Released 16 Mar 2011.

Method: Electron microscopy
Organism: Thermus thermophilus
Chains: 1
Atoms: 5,382
Mol. weight: 76.6 kDa
Released: 16 Mar 2011

Explore 3IZP in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3IZP contains 22 α-helices and 41 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain E: 22 helices, 41 β-strands

Element	Residues	Length	Sheet
α-helix	4-10	7
β-strand	15-19	5	1
α-helix	24-37	14
α-helix	55-60	6
β-strand	62	1	1
β-strand	70-74	5	2
β-strand	77-81	5	2
α-helix	91-100	10
β-strand	103-109	7	1
α-helix	116-127	12
β-strand	132-137	6	1
α-helix	146-156	11
β-strand	161-163	3	1
β-strand	166-168	3	3
β-strand	176-179	4	3
β-strand	184-188	5	3
β-strand	196-197	2	3
α-helix	199	1
β-strand	200	1	3
α-helix	201-202	2
α-helix	203-221	19
α-helix	225-233	9
α-helix	239-251	13
β-strand	256-260	5	1
α-helix	269-279	11
β-strand	289-292	4	4
β-strand	298-301	4	4
β-strand	310-318	9	5
β-strand	324-332	9	5
β-strand	335-336	2	6
β-strand	339-343	5	5
β-strand	348-358	11	5
β-strand	363-366	4	5
β-strand	368-369	2	6
β-strand	374-379	6	5
β-strand	388-390	3	5
β-strand	409-413	5	7
β-strand	414-415	2	8
α-helix	419-434	16
β-strand	438-439	2	7
β-strand	442-443	2	7
β-strand	448-453	6	7
α-helix	456-465	10
α-helix	466-470	5
β-strand	474-475	2	8
β-strand	484-486	3	9
β-strand	491-500	10	10
β-strand	505-516	12	10
β-strand	523-527	5	10
α-helix	536-538	3
α-helix	539-549	11
β-strand	560	1	9
β-strand	563-570	8	10
β-strand	577	1	10
α-helix	579-596	18
β-strand	600-612	13	9
α-helix	617-626	10
β-strand	631-637	7	9
β-strand	640-648	9	9
α-helix	649-651	3
α-helix	656-662	7
β-strand	668-678	11	9
α-helix	681-684	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Elongation factor G	E	protein	688	Thermus thermophilus	P13551 (AlphaFold model)

Sequence of entity 1 (E), FASTA

>3IZP_1 Elongation factor G (chains E)
MAVKVEYDLKRLRNIGIAAHIDAGKTTTTERILYYTGRIHKIGEVHEGAATMDFMEQERE
RGITITAAVTTCFWKDHRINIIDTPGHVDFTIEVERSMRVLDGAIVVFDSSQGVEPQSET
VWRQAEKYKVPRIAFANKMDKTGADLWLVIRTMQERLGARPVVMQLPIGREDTFSGIIDV
LRMKAYTYGNDLGTDIREIPIPEEYLDQAREYHEKLVEVAADFDENIMLKYLEGEEPTEE
ELVAAIRKGTIDLKITPVFLGSALKNKGVQLLLDAVVDYLPSPLDIPPIKGTTPEGEVVE
IHPDPNGPLAALAFKIMADPYVGRLTFIRVYSGTLTSGSYVYNTTKGRKERVARLLRMHA
NHREEVEELKAGDLGAVVGLKETITGDTLVGEDAPRVILESIEVPEPVIDVAIEPKTKAD
QEKLSQALARLAEEDPTFRVSTHPETGQTIISGMGELHLEIIVDRLKREFKVDANVGKPQ
VAYRETITKPVDVEGKFIRQTGGRGQYGHVKIKVEPLPRGSGFEFVNAIVGGVIPKEYIP
AVQKGIEEAMQSGPLIGFPVVDIKVTLYDGSYAEVDSSEMAFKIAGSMAIKEAVQKGDPV
ILEPIMRVEVTTPEEYMGDVIGDLNARRGQILGMEPRGNAQVIRAFVPLAEMFGYATDLR
SKTQGRGSFVMFFDHYQEVPKQVQEKLI

Primary citation

Molecular dynamics of EF-G during translocation. Li, W., Trabuco, L.G., Schulten, K. et al. Proteins (2011) 79:1478-1486. DOI 10.1002/prot.22976 · PubMed

Other PDB entries of the same protein (UniProt P13551 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2BM0 2.4 Å, Ribosomal elongation factor G (EF-G) Fusidic acid resistant mutant T84A
2BV3 2.5 Å, Crystal structure of a mutant elongation factor G trapped with a GTP analogue
2BM1 2.6 Å, Ribosomal elongation factor G (EF-G) Fusidic acid resistant mutant G16V
1FNM 2.8 Å, Structure of thermus thermophilus ef-G H573A
2J7K 2.9 Å, Crystal structure of the T84A mutant EF-G:GDPCP complex
4M1K 2.95 Å, Crystal structure of elongation factor G (EFG)
4MYU 3.0 Å, Crystal structure of elongation factor G mutant(EFG)
4MYT 3.5 Å, Crystal structure of elongation factor G (EFG)
1KTV 3.8 Å, Crystal Structure of Elongation Factor G Dimer Without Nucleotide
1PN6 10.8 Å, Domain-wise fitting of the crystal structure of T.thermophilus EF-G into the low…
2BCW 11.2 Å, Coordinates of the N-terminal domain of ribosomal protein L11,C-terminal domain of…
1JQM 18.0 Å, Fitting of L11 protein and elongation factor G (EF-G) in the cryo-em map of e. coli 70S…

Browse structure collections

About this viewer

MolViewer shows 3IZP directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.