3J04: Myosin-11

EM structure of the heavy meromyosin subfragment of Chick smooth muscle Myosin with regulatory light chain in phosphorylated state. Determined by electron microscopy at 20.0 Å resolution. Released 16 Nov 2011.

Method: Electron microscopy
Resolution: 20.0 Å
Organism: Gallus gallus
Chains: 6
Atoms: 19,065
Mol. weight: 275.79 kDa
Released: 16 Nov 2011

Explore 3J04 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3J04 contains 118 α-helices and 64 β-strands across 6 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 41 helices, 27 β-strands

Element	Residues	Length	Sheet
α-helix	10-12	3
α-helix	23-28	6
β-strand	34-38	5	1
β-strand	44-52	9	1
β-strand	56-61	6	1
β-strand	67-71	5	1
β-strand	76-77	2	1
α-helix	78-80	3
α-helix	81-83	3
β-strand	88	1	2
α-helix	89-91	3
α-helix	97-109	13
β-strand	114-117	4	2
β-strand	120-124	5	2
α-helix	135-141	7
α-helix	153-164	12
β-strand	171-176	6	2
α-helix	183-197	15
α-helix	199-201	3
α-helix	219-233	15
β-strand	236-237	2	3
β-strand	245-246	2	3
β-strand	250-256	7	2
β-strand	262-269	8	2
α-helix	274-276	3
α-helix	288-296	9
α-helix	299-304	6
α-helix	328-342	15
α-helix	346-361	16
α-helix	362-364	3
β-strand	368-369	2	4
β-strand	376-377	2	4
α-helix	382-389	8
α-helix	395-403	9
β-strand	406-407	2	5
β-strand	414-415	2	5
α-helix	420-449	30
β-strand	460-465	6	2
α-helix	477-494	18
α-helix	495-500	6
α-helix	501-508	8
α-helix	522-529	8
α-helix	537-544	8
α-helix	552-562	11
β-strand	569-571	3	6
β-strand	580-585	6	6
β-strand	588-593	6	6
α-helix	598-602	5
α-helix	607-614	8
α-helix	619-624	6
β-strand	637	1	7
β-strand	644	1	7
α-helix	652-654	3
α-helix	659-674	16
β-strand	678-685	8	2
α-helix	698-708	11
α-helix	710-718	9
β-strand	723-726	4	8
α-helix	727-734	8
α-helix	735-737	3
α-helix	749-759	11
β-strand	767-769	3	8
β-strand	773-776	4	8
α-helix	787-796	10
α-helix	803-812	10
α-helix	824-837	14
α-helix	839-850	12
α-helix	854-909	56

Chain B: 9 helices, 0 β-strands

Element	Residues	Length
α-helix	27-37	11
α-helix	50-59	10
α-helix	66-70	5
α-helix	82-91	10
α-helix	99-106	8
α-helix	122-127	6
α-helix	135-144	10
α-helix	152-153	2
α-helix	157-163	7

Chain C: 9 helices, 5 β-strands

Element	Residues	Length	Sheet
α-helix	5-16	12
β-strand	26-27	2	9
α-helix	31-37	7
α-helix	44-50	7
α-helix	56-59	4
β-strand	63-64	2	9
α-helix	66-77	12
α-helix	86-93	8
β-strand	102-104	3	10
α-helix	105-114	10
α-helix	121-128	8
β-strand	132	1	10
β-strand	137-139	3	10
α-helix	140-148	9

Chain D: 40 helices, 27 β-strands

Element	Residues	Length	Sheet
α-helix	10-12	3
α-helix	23-28	6
β-strand	34-39	6	11
β-strand	43-52	10	11
β-strand	56-61	6	11
β-strand	67-71	5	11
β-strand	76-77	2	11
α-helix	78-80	3
α-helix	81-83	3
β-strand	88	1	12
α-helix	89-91	3
α-helix	97-109	13
β-strand	114-116	3	12
β-strand	121-124	4	12
α-helix	135-141	7
α-helix	153-164	12
β-strand	171-176	6	12
α-helix	183-197	15
α-helix	219-233	15
β-strand	236-237	2	13
β-strand	245-246	2	13
β-strand	250-256	7	12
β-strand	262-269	8	12
α-helix	274-276	3
α-helix	288-296	9
α-helix	299-304	6
α-helix	328-342	15
α-helix	346-361	16
α-helix	362-364	3
β-strand	368-369	2	14
β-strand	376-377	2	14
α-helix	382-389	8
α-helix	395-403	9
β-strand	406-407	2	15
β-strand	414-415	2	15
α-helix	420-449	30
β-strand	460-465	6	12
α-helix	477-494	18
α-helix	495-500	6
α-helix	501-508	8
α-helix	522-529	8
α-helix	537-544	8
α-helix	552-562	11
β-strand	569-571	3	16
β-strand	580-585	6	16
β-strand	588-593	6	16
α-helix	598-602	5
α-helix	607-614	8
α-helix	619-624	6
β-strand	637	1	17
β-strand	644	1	17
α-helix	652-654	3
α-helix	659-674	16
β-strand	678-685	8	12
α-helix	698-708	11
α-helix	710-717	8
β-strand	723-726	4	18
α-helix	727-734	8
α-helix	735-737	3
α-helix	749-759	11
β-strand	767-769	3	18
β-strand	773-776	4	18
α-helix	780-786	7
α-helix	795-797	3
α-helix	798-815	18
α-helix	824-830	7
α-helix	840-907	68

Chain E: 10 helices, 0 β-strands

Element	Residues	Length
α-helix	27-40	14
α-helix	50-59	10
α-helix	62-65	4
α-helix	66-71	6
α-helix	82-92	11
α-helix	99-106	8
α-helix	121-127	7
α-helix	135-144	10
α-helix	152-153	2
α-helix	157-163	7

Chain F: 9 helices, 5 β-strands

Element	Residues	Length	Sheet
α-helix	5-16	12
β-strand	26-27	2	19
α-helix	31-37	7
α-helix	44-50	7
α-helix	56-61	6
β-strand	63-64	2	19
α-helix	66-77	12
α-helix	86-93	8
β-strand	102-104	3	20
α-helix	105-114	10
α-helix	121-128	8
β-strand	132	1	20
β-strand	137-139	3	20
α-helix	140-148	9

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Myosin-11	A, D	protein	909	Gallus gallus	P10587 (AlphaFold model)
Myosin regulatory light chain 2, smooth muscle major isoform	B, E	protein	143	Gallus gallus	P02612 (AlphaFold model)
Myosin light polypeptide 6	C, F	protein	148	Gallus gallus	P02607 (AlphaFold model)

Sequence of entity 1 (A, D), FASTA

>3J04_1 Myosin-11 (chains A, D)
SQKPLSDDEKFLFVDKNFVNNPLAQADWSAKKLVWVPSEKHGFEAASIKEEKGDEVTVEL
QENGKKVTLSKDDIQKMNPPKFSKVEDMAELTCLNEASVLHNLRERYFSGLIYTYSGLFC
VVINPYKQLPIYSEKIIDMYKGKKRHEMPPHIYAIADTAYRSMLQDREDQSILCTGESGA
GKTENTKKVIQYLAVVASSHKGKKDTSITQGPSFSYGELEKQLLQANPILEAFGNAKTVK
NDNSSRFGKFIRINFDVTGYIVGANIETYLLEKSRAIRQAKDERTFHIFYYLIAGASEQM
RNDLLLEGFNNYTFLSNGHVPIPAQQDDEMFQETLEAMTIMGFTEEEQTSILRVVSSVLQ
LGNIVFKKERNTDQASMPDNTAAQKVCHLMGINVTDFTRSILTPRIKVGRDVVQKAQTKE
QADFAIEALAKAKFERLFRWILTRVNKALDKTKRQGASFLGILDIAGFEIFEINSFEQLC
INYTNEKLQQLFNHTMFILEQEEYQREGIEWNFIDFGLDLQPCIELIERPTNPPGVLALL
DEECWFPKATDTSFVEKLIQEQGNHAKFQKSKQLKDKTEFCILHYAGKVTYNASAWLTKN
MDPLNDNVTSLLNQSSDKFVADLWKDVDRIVGLDQMAKMTESSLPSASKTKKGMFRTVGQ
LYKEQLTKLMTTLRNTNPNFVRCIIPNHEKRAGKLDAHLVLEQLRCNGVLEGIRICRQGF
PNRIVFQEFRQRYEILAANAIPKGFMDGKQACILMIKALELDPNLYRIGQSKIFFRTGVL
AHLEEERDLKITDVIIAFQAQCRGYLARKAFAKRQQQLTAMKVIQRNCAAYLKLRNWQWW
RLFTKVKPLLQVTRQEEEMQAKDEELQRTKERQQKAEAELKELEQKHTQLCEEKNLLQEK
LQAETELYA

Sequence of entity 2 (B, E), FASTA

>3J04_2 Myosin regulatory light chain 2, smooth muscle major isoform (chains B, E)
FDQSQIQEFKEAFNMIDQNRDGFIDKEDLHDMLASMGKNPTDEYLEGMMSEAPGPINFTM
FLTMFGEKLNGTDPEDVIRNAFACFDEEASGFIHEDHLRELLTTMGDRFTDEEVDEMYRE
APIDKKGNFNYVEFTRILKHGAK

Sequence of entity 3 (C, F), FASTA

>3J04_3 Myosin light polypeptide 6 (chains C, F)
FSEEQTAEFKEAFQLFDRTGDGKILYSQCGDVMRALGQNPTNAEVMKVLGNPKSDEMNLK
TLKFEQFLPMMQTIAKNKDQGCFEDYVEGLRVFDKEGNGTVMGAEIRHVLVTLGEKMTEE
EVEQLVAGHEDSNGCINYEELVRMVLSG

Primary citation

Phosphorylated smooth muscle heavy meromyosin shows an open conformation linked to activation. Baumann, B.A., Taylor, D.W., Huang, Z. et al. J Mol Biol (2012) 415:274-287. DOI 10.1016/j.jmb.2011.10.047 · PubMed

Other PDB entries of the same protein (UniProt P10587 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5M05 2.67 Å, Chicken smooth muscle myosin motor domain co-crystallized with the specific CK-571…
5T45 2.8 Å, Chicken smooth muscle myosin motor domain co-crystallized with the specific CK-571…
1BR2 2.9 Å, Smooth muscle myosin motor domain complexed with MGADP.ALF4
7MF3 3.4 Å, Structure of the autoinhibited state of smooth muscle myosin-2
1BR1 3.5 Å, Smooth muscle myosin motor domain-essential light chain complex with MGADP.ALF4 bound at…
1BR4 3.62 Å, Smooth muscle myosin motor domain-essential light chain complex with MGADP.BEF3 bound at…
6BIH 6.0 Å, The Structure of the Actin-Smooth Muscle Myosin Motor Domain Complex in the Rigor State
8SYF 19.0 Å, Homology model of Acto-HMM complex in ADP-state. Chicken smooth muscle HMM and chicken…
1I84 20.0 Å, cryo-EM structure of the heavy meromyosin subfragment of chicken gizzard smooth muscle…
3DTP 20.0 Å, Tarantula heavy meromyosin obtained by flexible docking to Tarantula muscle thick…

Browse structure collections

About this viewer

MolViewer shows 3J04 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.