3J42: Envelope protein E

Obstruction of Dengue Virus Maturation by Fab Fragments of the 2H2 Antibody. Determined by electron microscopy at 21.0 Å resolution. Released 17 Jul 2013.

Method: Electron microscopy
Resolution: 21.0 Å
Organisms: Dengue virus 2, Mus musculus
Chains: 12
Atoms: 11,226
Mol. weight: 299.14 kDa
Released: 17 Jul 2013

Explore 3J42 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3J42 contains 54 α-helices and 126 β-strands across 6 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chains G, I and K: 8 helices, 21 β-strands

Element	Residues	Length	Sheet
β-strand	3-7	5	1
β-strand	10-12	3	2
β-strand	18-25	8	1
α-helix	29-31	3
β-strand	33-39	7	2
β-strand	45-51	7	2
β-strand	58-60	3	2
β-strand	68-73	6	1
β-strand	78-83	6	1
α-helix	88-90	3
β-strand	92-100	9	2
β-strand	106-110	5	2
β-strand	114-118	5	2
α-helix	122-123	2
β-strand	124	1	3
α-helix	125-126	2
β-strand	127-131	5	4
β-strand	142-152	11	4
β-strand	153	1	3
β-strand	158-161	4	5
α-helix	162-164	3
β-strand	171-172	2	4
α-helix	173-175	3
β-strand	176-178	3	4
β-strand	181-191	11	4
α-helix	192-194	3
β-strand	201-206	6	5
α-helix	207-209	3
β-strand	211-216	6	5

Chains H, J and L: 10 helices, 21 β-strands

Element	Residues	Length	Sheet
β-strand	1004-1007	4	6
β-strand	1010-1013	4	7
β-strand	1018-1025	8	6
β-strand	1033-1038	6	7
α-helix	1043-1044	2
β-strand	1045-1049	5	7
β-strand	1053-1054	2	7
α-helix	1055	1
β-strand	1062-1067	6	6
β-strand	1070-1076	7	6
α-helix	1080-1082	3
β-strand	1084-1090	7	7
α-helix	1096	1
β-strand	1097-1098	2	7
β-strand	1102-1106	5	7
β-strand	1111	1	8
α-helix	1112-1113	2
β-strand	1114-1118	5	9
α-helix	1119-1121	3
α-helix	1122-1125	4
β-strand	1129-1139	11	9
β-strand	1140	1	8
β-strand	1145-1150	6	10
β-strand	1153-1155	3	10
β-strand	1159-1163	5	9
α-helix	1164-1167	4
β-strand	1173-1182	10	9
α-helix	1183-1186	4
β-strand	1191-1197	7	10
α-helix	1204	1
β-strand	1205-1210	6	10

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Envelope protein E	A, B, C	protein	390	Dengue virus 2	A7TUD3
PrM	D, E, F	protein	81	Dengue virus 2	P29990
Ig heavy chain V region MOPC 21, Igh protein chimera	G, I, K	protein	221	Mus musculus	P01865 (AlphaFold model)
Ig kappa chain V-V region MOPC 21, Anti-colorectal carcinoma light chain chimera	H, J, L	protein	212	Mus musculus	P01837 (AlphaFold model)

Sequence of entity 1 (A, B, C), FASTA

>3J42_1 Envelope protein E (chains A, B, C)
MRCIGISNRDFVEGVSSWVDIVLEHGSCVTTMAKNKPTLDFELIKTEAKPATLRKYCIEA
KLTNTTTESRCPTQGEPSLNEEQDKRFVCKHSMVDRGWGNGCGLFGKGGIVTCAMFRCKK
NMEGKVVQPENLEYTVVITPHSGEEHAVGNDTGKHGKEVKITPQSSITEAELTGYGTVTM
ECSPRTGLDEMVLLQMENKAWLVHRQWFLDLPLPWLPGADTQGSNWIQKETLVTFKNPHA
KKQDVVVLGSQEGAMHTALTGATEIQMSSGNLLFTGHLKCRLRMDKLQLKGMSYSMCTGK
FKVVKEIAETQHGTIVIRVQYEGDGSPCKIPFEIMDLEKRHVLGRLITVNPIVTEKDSPV
NIEAEPPFGDSYIIIGVEPGQLKLDWFKKG

Sequence of entity 2 (D, E, F), FASTA

>3J42_2 PrM (chains D, E, F)
FHLTTRNGEPHMIVSRQEKGKSLLFKTEDGVNMCTLMAMDLGELCEDTITYKCPLLRQNE
PEDIDCWCNSTSTWVTYGTCT

Sequence of entity 3 (G, I, K), FASTA

>3J42_3 Ig heavy chain V region MOPC 21, Igh protein chimera (chains G, I, K)
DVQLVESGGGLVQPGGSRKLSCAASGFTFSSFGMHWVRQAPEKGLEWVAYISSGSSTLHY
ADTVKGRFTISRDNPKNTLFLQMTSLRSEDTAMYYCARWGNYPHYAMDYWGQGTSVTVSS
AKTTAPSVYPLAPVCGDTTGSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSG
LYTLSSSVTVTSSTWPSQTITCNVAHPASSTKVDKKIEPRV

Sequence of entity 4 (H, J, L), FASTA

>3J42_4 Ig kappa chain V-V region MOPC 21, Anti-colorectal carcinoma light chain chimera (chains H, J, L)
NIVMTQSPKSMSMSVGERVTLTCKASENVGTYVSWYQQKPEQSPKLLIYGASNRYTGVPD
RFTGSGSATDFTLTISSVQAEDLADYHCGQSYSTPYTFGGGTKLEIKRADAAPTVSIFPP
SSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLT
LTKDEYERHNSYTCEATHKTSTSPIVKSFNRN

Primary citation

Obstruction of Dengue Virus Maturation by Fab Fragments of the 2H2 Antibody. Wang, Z., Li, L., Pennington, J.G. et al. J Virol (2013) 87:8909-8915. DOI 10.1128/JVI.00472-13 · PubMed

Other PDB entries of the same protein (UniProt A7TUD3), best resolution first:

3C6D 12.5 Å, The pseudo-atomic structure of dengue immature virus

Browse structure collections

About this viewer

MolViewer shows 3J42 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.