3JSY: Acidic ribosomal protein P0 homolog

Name: PDB 3JSY: N-terminal fragment of ribosomal protein L10 from Methanococcus jannaschii
Published: 2010-05-26
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: ribosomal protein

N-terminal fragment of ribosomal protein L10 from Methanococcus jannaschii. Determined by X-ray diffraction at 1.6 Å resolution. Released 26 May 2010.

Method: X-ray diffraction
Resolution: 1.6 Å
Organism: Methanocaldococcus jannaschii
Chains: 2
Atoms: 3,640
Mol. weight: 46.71 kDa
Released: 26 May 2010

Explore 3JSY in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3JSY contains 29 α-helices and 28 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 16 helices, 14 β-strands

Element	Residues	Length	Sheet
α-helix	11-26	16
β-strand	29-34	6	1
α-helix	40-50	11
β-strand	54-58	5	1
α-helix	61-74	14
α-helix	78-86	9
β-strand	91-96	6	1
α-helix	100-104	5
α-helix	105-109	5
α-helix	111	1
β-strand	112-114	3	2
α-helix	115-117	3
α-helix	120	1
β-strand	121	1	3
α-helix	122	1
β-strand	126-128	3	4
β-strand	131-135	5	5
α-helix	136	1
α-helix	140-146	7
β-strand	151-154	4	5
β-strand	157-160	4	5
β-strand	164-167	4	4
β-strand	172	1	3
α-helix	173-174	2
α-helix	175-183	9
β-strand	189-191	3	2
β-strand	194-200	7	1
β-strand	203-205	3	1
α-helix	206	1
α-helix	207-213	7

Chain B: 13 helices, 14 β-strands

Element	Residues	Length	Sheet
α-helix	11-24	14
β-strand	29-34	6	6
α-helix	40-50	11
β-strand	54-58	5	6
α-helix	61-75	15
α-helix	78-86	9
β-strand	91-96	6	6
α-helix	100-109	10
β-strand	112-114	3	7
α-helix	115-117	3
α-helix	120	1
β-strand	121	1	8
α-helix	122	1
β-strand	126-128	3	9
β-strand	131-135	5	10
α-helix	136	1
α-helix	140-146	7
β-strand	151-154	4	10
β-strand	157-160	4	10
β-strand	164-167	4	9
β-strand	172	1	8
α-helix	173-174	2
α-helix	175-183	9
β-strand	189-191	3	7
β-strand	194-200	7	6
β-strand	203-205	3	6
α-helix	207-210	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Acidic ribosomal protein P0 homolog	A, B	protein	213	Methanocaldococcus jannaschii	P54049 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>3JSY_1 Acidic ribosomal protein P0 homolog (chains A, B)
MAPWKIEEVKTLKGLIKSKPVVAIVDMMDVPAPQLQEIRDKIRDKVKLRMSRNTLIIRAL
KEAAEELNNPKLAELANYVERGAAILVTDMNPFKLYKLLEENKSPAPVRGGQIAPCDIKV
EKGSTGMPPGPFLGELKSVGIPAAIEKGKIAIKEDKVVVKKGEVVSPKLAAVLDRLGIKP
IKVGLNILAVYEDGIIYTPDVLKVDEEKLLADI

Primary citation

Structure of a two-domain N-terminal fragment of ribosomal protein L10 from Methanococcus jannaschii reveals a specific piece of the archaeal ribosomal stalk. Kravchenko, O., Mitroshin, I., Nikonov, S. et al. J Mol Biol (2010) 399:214-220. DOI 10.1016/j.jmb.2010.04.017 · PubMed

Other PDB entries of the same protein (UniProt P54049 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5D8H 2.8 Å, Crystal structure of the base of the ribosomal P stalk from methanococcus jannaschii…
5DAR 2.9 Å, Crystal structure of the base of the ribosomal P stalk from methanococcus jannaschii
5D6G 3.3 Å, Crystal structure of fragment of ribosomal protein P0 in complex with 74NT 23S RNA from…

Browse structure collections

About this viewer

MolViewer shows 3JSY directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.