Structure of SH3E-DH unit of murine intersectin-1L. Determined by X-ray diffraction at 2.4 Å resolution. Released 14 Jul 2010.
Explore 3JV3 in 3D Show helices and sheets RCSB PDB PDBe
3JV3 contains 35 α-helices and 8 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 1151-1155 | 5 | 1 |
| β-strand | 1159 | 1 | 2 |
| β-strand | 1166 | 1 | 1 |
| β-strand | 1169 | 1 | 2 |
| β-strand | 1174-1179 | 6 | 1 |
| β-strand | 1185-1190 | 6 | 1 |
| β-strand | 1193-1198 | 6 | 1 |
| α-helix | 1199-1201 | 3 | |
| β-strand | 1202-1204 | 3 | 1 |
| α-helix | 1205-1207 | 3 | |
| α-helix | 1210-1214 | 5 | |
| α-helix | 1221-1223 | 3 | |
| α-helix | 1226-1252 | 27 | |
| α-helix | 1253-1257 | 5 | |
| α-helix | 1258-1261 | 4 | |
| α-helix | 1268-1275 | 8 | |
| α-helix | 1278-1299 | 22 | |
| α-helix | 1303-1305 | 3 | |
| α-helix | 1309-1315 | 7 | |
| α-helix | 1316-1319 | 4 | |
| α-helix | 1321-1342 | 22 | |
| α-helix | 1344-1353 | 10 | |
| α-helix | 1357-1359 | 3 | |
| α-helix | 1364-1367 | 4 | |
| α-helix | 1370-1386 | 17 | |
| α-helix | 1396-1422 | 27 | |
| α-helix | 1423-1425 | 3 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 1210-1214 | 5 | |
| α-helix | 1221-1223 | 3 | |
| α-helix | 1226-1252 | 27 | |
| α-helix | 1253-1257 | 5 | |
| α-helix | 1258-1263 | 6 | |
| α-helix | 1268-1275 | 8 | |
| α-helix | 1278-1299 | 22 | |
| α-helix | 1303-1305 | 3 | |
| α-helix | 1309-1315 | 7 | |
| α-helix | 1316-1319 | 4 | |
| α-helix | 1321-1342 | 22 | |
| α-helix | 1344-1354 | 11 | |
| α-helix | 1357-1359 | 3 | |
| α-helix | 1364-1367 | 4 | |
| α-helix | 1370-1387 | 18 | |
| α-helix | 1396-1423 | 28 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Intersectin-1 | A, B | protein | 283 | Mus musculus | Q9Z0R4 (AlphaFold model) |
>3JV3_1 Intersectin-1 (chains A, B) GSCQVIGMYDYTAQNDDELAFSKGQIINVLNKEDPDWWKGEVSGQVGLFPSNYVKLTTDM DPSQQWCSDLHLLDMLTPTERKRQGYIHELIVTEENYVNDLQLVTEIFQKPLTESELLTE KEVAMIFVNWKELIMCNIKLLKALRVRKKMSGEKMPVKMIGDILSAQLPHMQPYIRFCSC QLNGAALIQQKTDEAPDFKEFVKRLAMDPRCKGMPLSSFILKPMQRVTRYPLIIKNILEN TPENHPDHSHLKHALEKAEELCSQVNEGVREKENSDRLEWIQA
The minimal autoinhibited unit of the guanine nucleotide exchange factor intersectin. Ahmad, K.F., Lim, W.A. PLoS One (2010) 5:e11291-e11291. DOI 10.1371/journal.pone.0011291 · PubMed
Other PDB entries of the same protein (UniProt Q9Z0R4 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 3JV3 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.