3JV5: Dimerization domains p52 homodimer

Crystal structure of the dimerization domains p52 homodimer. Determined by X-ray diffraction at 2.65 Å resolution. Released 24 Nov 2010.

Method: X-ray diffraction
Resolution: 2.65 Å
Organism: Mus musculus
Chains: 4
Atoms: 3,562
Mol. weight: 48.41 kDa
Released: 24 Nov 2010

Explore 3JV5 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3JV5 contains 9 α-helices and 49 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 3 helices, 12 β-strands

Element	Residues	Length	Sheet
β-strand	228	1	1
β-strand	230-233	4	2
β-strand	237-239	3	3
β-strand	245-250	6	2
α-helix	255-257	3
β-strand	258-263	6	3
β-strand	271-273	3	3
β-strand	275	1	2
α-helix	278-280	3
α-helix	282-284	3
β-strand	286-290	5	2
β-strand	303-311	9	3
β-strand	317	1	3
β-strand	318	1	1
β-strand	321-326	6	3

Chain B: 2 helices, 13 β-strands

Element	Residues	Length	Sheet
β-strand	228	1	4
β-strand	230-233	4	5
β-strand	237-239	3	6
β-strand	245-250	6	5
β-strand	259-263	5	6
β-strand	271-273	3	6
β-strand	275	1	5
α-helix	278-280	3
β-strand	281-282	2	5
β-strand	286-290	5	5
α-helix	291-294	4
β-strand	303-310	8	6
β-strand	317	1	6
β-strand	318	1	4
β-strand	321-326	6	6

Chain C: 3 helices, 13 β-strands

Element	Residues	Length	Sheet
β-strand	228	1	7
β-strand	230-233	4	8
β-strand	237-239	3	9
β-strand	245-250	6	8
β-strand	259-263	5	9
β-strand	271-273	3	9
β-strand	275	1	8
α-helix	278-280	3
β-strand	281-282	2	8
β-strand	286-290	5	8
α-helix	291-294	4
β-strand	303-310	8	9
β-strand	317	1	9
β-strand	318	1	7
α-helix	319-320	2
β-strand	321-326	6	9

Chain D: 1 helix, 11 β-strands

Element	Residues	Length	Sheet
β-strand	230-233	4	10
β-strand	238-239	2	11
β-strand	245-250	6	10
β-strand	259-263	5	11
β-strand	271-273	3	11
β-strand	275	1	10
β-strand	281-282	2	10
β-strand	286-290	5	10
α-helix	291-294	4
β-strand	303-310	8	11
β-strand	317	1	11
β-strand	321-326	6	11

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Nuclear factor NF-kappa-B p100 subunit	A, B, C, D	protein	104	Mus musculus	Q9WTK5 (AlphaFold model)

Sequence of entity 1 (A, B, C, D), FASTA

>3JV5_1 Nuclear factor NF-kappa-B p100 subunit (chains A, B, C, D)
ASNLKISRMDKTAGSVRGGDEVYLLCDKVQKDDIEVRFYEDDENGWQAFGDFSPTDVHKQ
YAIVFRTPPYHKMKIERPVTVFLQLKRKRGGDVSDSKQFTYYPL

Primary citation

Instability of the RelB dimerization domain is functionally important. Vu, D., Huang, D.B., Ghosh, G. To be published.

Other PDB entries of the same protein (UniProt Q9WTK5 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3JV6 2.78 Å, Crystal structure of the dimerization domains p52 and RelB

Browse structure collections

About this viewer

MolViewer shows 3JV5 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.