3JXT: Third PDZ domain of SAP-102

Crystal structure of the third PDZ domain of SAP-102 in complex with a fluorogenic peptide-based ligand. Determined by X-ray diffraction at 1.5 Å resolution. Released 29 Sept 2010.

Method: X-ray diffraction
Resolution: 1.5 Å
Organism: Rattus norvegicus
Chains: 4
Atoms: 1,893
Mol. weight: 24.1 kDa
Released: 29 Sept 2010

Explore 3JXT in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3JXT contains 6 α-helices and 18 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 3 helices, 8 β-strands

Element	Residues	Length	Sheet
β-strand	403-408	6	1
β-strand	410	1	2
β-strand	413	1	2
β-strand	416-420	5	1
β-strand	427-432	6	1
α-helix	437-441	5
β-strand	448-453	6	1
β-strand	456-457	2	1
α-helix	463-472	10
β-strand	476-483	8	1
α-helix	485-488	4

Chain B: 3 helices, 8 β-strands

Element	Residues	Length	Sheet
β-strand	403-407	5	3
β-strand	410	1	4
β-strand	413	1	4
β-strand	416-420	5	3
β-strand	427-432	6	3
α-helix	437-441	5
β-strand	448-453	6	3
β-strand	456-457	2	3
α-helix	463-471	9
β-strand	477-483	7	3
α-helix	485-488	4

Chains C and D: 0 helices, 1 β-strand

Element	Residues	Length	Sheet
β-strand	104-105	2	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Disks large homolog 3	A, B	protein	104	Rattus norvegicus	Q62936 (AlphaFold model)
Voltage-dependent calcium channel gamma-2 subunit	C, D	protein	7		O88602 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>3JXT_1 Disks large homolog 3 (chains A, B)
SGSLAEEDFTREPRKIILHKGSTGLGFNIVGGEDGEGIFVSFILAGGPADLSGELRRGDR
ILSVNGVNLRNATHEQAAAALKRAGQSVTIVAQYRPEEYSRFES

Sequence of entity 2 (C, D), FASTA

>3JXT_2 Voltage-dependent calcium channel gamma-2 subunit (chains C, D)
XXRTTPV

Primary citation

Caged mono- and divalent ligands for light-assisted disruption of PDZ domain-mediated interactions. Sainlos, M., Iskenderian-Epps, W.S., Olivier, N.B. et al. J Am Chem Soc (2013) 135:4580-4583. DOI 10.1021/ja309870q · PubMed

Browse structure collections

About this viewer

MolViewer shows 3JXT directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.