3JZA: Human Rab1b

Crystal structure of human Rab1b in complex with the GEF domain of DrrA/SidM from Legionella pneumophila. Determined by X-ray diffraction at 1.8 Å resolution. Released 19 Jan 2010.

Method: X-ray diffraction
Resolution: 1.8 Å
Organisms: Homo sapiens, Legionella pneumophila subsp. pneumophila str. Philadelphia 1
Chains: 2
Atoms: 3,101
Mol. weight: 41.86 kDa
Ligands: PO4
Released: 19 Jan 2010

Explore 3JZA in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3JZA contains 20 α-helices and 9 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 7 helices, 7 β-strands

Element	Residues	Length	Sheet
β-strand	7-14	8	1
α-helix	21-24	4
β-strand	29	1	1
α-helix	36-41	6
β-strand	45-52	8	1
β-strand	55-63	9	1
α-helix	67-69	3
α-helix	75-78	4
β-strand	83-89	7	1
α-helix	93-109	17
β-strand	115-121	7	1
α-helix	133-143	11
β-strand	147-150	4	1
α-helix	156-172	17

Chain B: 13 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	342-361	20
α-helix	365-381	17
α-helix	386-389	4
α-helix	390-393	4
α-helix	400-419	20
α-helix	428-447	20
α-helix	449	1
α-helix	452-454	3
α-helix	458-460	3
α-helix	461-463	3
α-helix	464-478	15
β-strand	484-485	2	2
β-strand	488-489	2	2
α-helix	490-506	17
α-helix	512-520	9

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Ras-related protein Rab-1B	A	protein	175	Homo sapiens	Q9H0U4 (AlphaFold model)
Uncharacterized protein DrrA	B	protein	197	Legionella pneumophila subsp. pneumophila str. Philadelphia 1	Q5ZSQ3 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>3JZA_1 Ras-related protein Rab-1B (chains A)
GHMPEYDYLFKLLLIGDSGVGKSCLLLRFADDTYTESYISTIGVDFKIRTIELDGKTIKL
QIWDTAGQERFRTITSSYYRGAHGIIVVYDVTDQESYANVKQWLQEIDRYASENVNKLLV
GNKSDLTTKKVVDNTTAKEFADSLGIPFLETSAKNATNVEQAFMTMAAEIKKRMG

Sequence of entity 2 (B), FASTA

>3JZA_2 Uncharacterized protein DrrA (chains B)
GHMVTRIENLENAKKLWDNANSMLEKGNISGYLKAANELHKFMKEKNLKEDDLRPELSDK
TISPKGYAILQSLWGAASDYSRAAATLTESTVEPGLVSAVNKMSAFFMDCKLSPNERATP
DPDFKVGKSKILVGIMQFIKDVADPTSKIWMHNTKALMNHKIAAIQKLERSNNVNDETLE
SVLSSKGENLSEYLSYK

Ligands and cofactors

ID	Name	Formula	Copies
PO4	Phosphate ion	O4 P	1

Primary citation

RabGDI displacement by DrrA from Legionella is a consequence of its guanine nucleotide exchange activity. Schoebel, S., Oesterlin, L.K., Blankenfeldt, W. et al. Mol Cell (2009) 36:1060-1072. DOI 10.1016/j.molcel.2009.11.014 · PubMed

Other PDB entries of the same protein (UniProt Q9H0U4 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3NKV 1.7 Å, Crystal structure of Rab1b covalently modified with AMP at Y77
8ALK 2.15 Å, Structure of the Legionella phosphocholine hydrolase Lem3 in complex with its substrate…
5SZH 2.3 Å, Structure of human Rab1b in complex with the bMERB domain of Mical-cL
5O74 2.5 Å, Crystal structure of human Rab1b covalently bound to the GEF domain of DrrA/SidM from…
4I1O 2.7 Å, Crystal structure of the Legionella pneumophila GAP domain of LepB in complex with Rab1b…
5SZK 2.8 Å, Structure of human N-terminally engineered Rab1b in complex with the bMERB domain of…
6SKU 3.2 Å, Legionella effector AnkX in complex with human Rab1b
4HLQ 3.3 Å, Crystal structure of human rab1b bound to GDP and BEF3 in complex with the GAP domain of…

Browse structure collections

About this viewer

MolViewer shows 3JZA directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.