3K3N: Catalytic core domain of human PHF8

Crystal structure of the catalytic core domain of human PHF8. Determined by X-ray diffraction at 2.4 Å resolution. Released 19 Jan 2010.

Method: X-ray diffraction
Resolution: 2.4 Å
Organism: Homo sapiens
Chains: 1
Atoms: 2,760
Mol. weight: 43.34 kDa
Ligands: FE2
Released: 19 Jan 2010

Explore 3K3N in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3K3N contains 19 α-helices and 14 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 19 helices, 14 β-strands

Element	Residues	Length	Sheet
β-strand	97-98	2	1
α-helix	99-101	3
β-strand	104	1	1
α-helix	113-119	7
β-strand	125-127	3	1
β-strand	136	1	2
α-helix	144-151	8
β-strand	156-161	6	1
β-strand	166-171	6	1
α-helix	172-179	8
β-strand	188-194	7	1
α-helix	200-202	3
β-strand	205	1	2
α-helix	208-213	6
α-helix	215-219	5
α-helix	227-229	3
β-strand	234-238	5	1
β-strand	242-247	6	1
α-helix	250-252	3
β-strand	254-269	16	1
α-helix	273-283	11
α-helix	288-290	3
α-helix	293-295	3
β-strand	301-306	6	1
β-strand	310-313	4	1
β-strand	318-334	17	1
α-helix	340-353	14
α-helix	364-384	21
α-helix	388-390	3
α-helix	391-408	18
α-helix	413-415	3
α-helix	417-419	3
α-helix	426-441	16

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
PHD finger protein 8	A	protein	371	Homo sapiens	Q9UPP1 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>3K3N_1 PHD finger protein 8 (chains A)
MTFVRELRSRTFDSSDEVILKPTGNQLTVEFLEENSFSVPILVLKKDGLGMTLPSPSFTV
RDVEHYVGSDKEIDVIDVTRQADCKMKLGDFVKYYYSGKREKVLNVISLEFSDTRLSNLV
ETPKIVRKLSWVENLWPEECVFERPNVQKYCLMSVRDSYTDFHIDFGGTSVWYHVLKGEK
IFYLIRPTNANLTLFECWSSSSNQNEMFFGDQVDKCYKCSVKQGQTLFIPTGWIHAVLTP
VDCLAFGGNFLHSLNIEMQLKAYEIEKRLSTADLFRFPNFETICWYVGKHILDIFRGLRE
NRRHPASYLVHGGKALNLAFRAWTRKEALPDHEDEIPETVRTVQLIKDLAREIRLVEDIF
QQNLEHHHHHH

Ligands and cofactors

ID	Name	Formula	Copies
FE2	FE (II) ion	Fe	1

Primary citation

Structural insights into a novel histone demethylase PHF8. Yu, L., Wang, Y., Huang, S. et al. Cell Res (2010) 20:166-173. DOI 10.1038/cr.2010.8 · PubMed

Other PDB entries of the same protein (UniProt Q9UPP1 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7CMZ 1.7 Å, Crystal Structure of BRCT7/8 in Complex with the APS Motif of PHF8
3K3O 2.1 Å, Crystal structure of the catalytic core domain of human PHF8 complexed with…
2WWU 2.15 Å, Crystal structure of the catalytic domain of PHD finger protein 8
3KV4 2.19 Å, Structure of PHF8 in complex with histone H3
4DO0 2.55 Å, Crystal Structure of human PHF8 in complex with Daminozide

Browse structure collections

About this viewer

MolViewer shows 3K3N directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.