Crystal structure of the catalytic core domain of human PHF8 complexed with alpha-ketoglutarate. Determined by X-ray diffraction at 2.1 Å resolution. Released 19 Jan 2010.
Explore 3K3O in 3D Show helices and sheets RCSB PDB PDBe
3K3O contains 18 α-helices and 14 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 97 | 1 | 1 |
| β-strand | 104 | 1 | 1 |
| α-helix | 113-119 | 7 | |
| β-strand | 125-127 | 3 | 1 |
| β-strand | 136 | 1 | 2 |
| α-helix | 144-151 | 8 | |
| β-strand | 156-161 | 6 | 1 |
| β-strand | 166-171 | 6 | 1 |
| α-helix | 172-179 | 8 | |
| β-strand | 188-194 | 7 | 1 |
| α-helix | 199-202 | 4 | |
| β-strand | 205 | 1 | 2 |
| α-helix | 208-213 | 6 | |
| α-helix | 215-219 | 5 | |
| α-helix | 227-229 | 3 | |
| β-strand | 234-238 | 5 | 1 |
| β-strand | 242-247 | 6 | 1 |
| α-helix | 250-252 | 3 | |
| β-strand | 254-269 | 16 | 1 |
| α-helix | 273-283 | 11 | |
| α-helix | 288-290 | 3 | |
| α-helix | 293-295 | 3 | |
| β-strand | 301-306 | 6 | 1 |
| β-strand | 310-313 | 4 | 1 |
| β-strand | 318-334 | 17 | 1 |
| α-helix | 340-353 | 14 | |
| α-helix | 364-384 | 21 | |
| α-helix | 388-390 | 3 | |
| α-helix | 391-408 | 18 | |
| α-helix | 413-415 | 3 | |
| α-helix | 417-419 | 3 | |
| α-helix | 426-441 | 16 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| PHD finger protein 8 | A | protein | 371 | Homo sapiens | Q9UPP1 (AlphaFold model) |
>3K3O_1 PHD finger protein 8 (chains A) MTFVRELRSRTFDSSDEVILKPTGNQLTVEFLEENSFSVPILVLKKDGLGMTLPSPSFTV RDVEHYVGSDKEIDVIDVTRQADCKMKLGDFVKYYYSGKREKVLNVISLEFSDTRLSNLV ETPKIVRKLSWVENLWPEECVFERPNVQKYCLMSVRDSYTDFHIDFGGTSVWYHVLKGEK IFYLIRPTNANLTLFECWSSSSNQNEMFFGDQVDKCYKCSVKQGQTLFIPTGWIHAVLTP VDCLAFGGNFLHSLNIEMQLKAYEIEKRLSTADLFRFPNFETICWYVGKHILDIFRGLRE NRRHPASYLVHGGKALNLAFRAWTRKEALPDHEDEIPETVRTVQLIKDLAREIRLVEDIF QQNLEHHHHHH
Structural insights into a novel histone demethylase PHF8. Yu, L., Wang, Y., Huang, S. et al. Cell Res (2010) 20:166-173. DOI 10.1038/cr.2010.8 · PubMed
Other PDB entries of the same protein (UniProt Q9UPP1 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 3K3O directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.