3KHQ: Murine Ig-beta (CD79b) in the monomeric form

Crystal structure of murine Ig-beta (CD79b) in the monomeric form. Determined by X-ray diffraction at 1.7 Å resolution. Released 25 Aug 2010.

Method: X-ray diffraction
Resolution: 1.7 Å
Organism: Mus musculus
Chains: 1
Atoms: 849
Mol. weight: 15.6 kDa
Ligands: GSH, FLC, MG
Released: 25 Aug 2010

Explore 3KHQ in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3KHQ contains 2 α-helices and 9 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 2 helices, 9 β-strands

Element	Residues	Length	Sheet
β-strand	46-49	4	1
β-strand	52-55	4	2
β-strand	61-67	7	1
β-strand	73-78	6	2
α-helix	83-84	2
β-strand	85-86	2	2
β-strand	94-99	6	1
β-strand	102-107	6	1
α-helix	112-114	3
β-strand	116-122	7	2
β-strand	137-141	5	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
B-cell antigen receptor complex-associated protein beta chain	A	protein	133	Mus musculus	P15530 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>3KHQ_1 B-cell antigen receptor complex-associated protein beta chain (chains A)
PAMTSSDLPLNFQGSPCSQIWQHPRFAAKKRSSMVKFHCYTNHSGALTWFRKRGSQQPQE
LVSEEGRIVQTQNGSVYTLTIQNIQYEDNGIYFCKQKCDSANHNVTDSCGTELLVLGFST
LDQLKRRNTLKDG

Ligands and cofactors

ID	Name	Formula	Copies
GSH	Glutathione	C10 H17 N3 O6 S	1
FLC	Citrate anion	C6 H5 O7	1
MG	Magnesium ion	Mg	1

Primary citation

Structural and Functional Studies of Igalphabeta and Its Assembly with the B Cell Antigen Receptor. Radaev, S., Zou, Z., Tolar, P. et al. Structure (2010) 18:934-943. DOI 10.1016/j.str.2010.04.019 · PubMed

Other PDB entries of the same protein (UniProt P15530 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3KHO 3.11 Å, Crystal structure of murine Ig-beta (CD79b) homodimer
8E4C 4.0 Å, IgM BCR fab truncated form
8EMA 8.2 Å, mouse full length B cell receptor

Browse structure collections

About this viewer

MolViewer shows 3KHQ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.