3KNV: RING and first zinc finger domains of TRAF2

Crystal structure of the RING and first zinc finger domains of TRAF2. Determined by X-ray diffraction at 1.9 Å resolution. Released 24 Nov 2009.

Method: X-ray diffraction
Resolution: 1.9 Å
Organism: Homo sapiens
Chains: 1
Atoms: 1,035
Mol. weight: 15.6 kDa
Ligands: ZN
Released: 24 Nov 2009

Explore 3KNV in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3KNV contains 12 α-helices and 10 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 12 helices, 10 β-strands

Element	Residues	Length	Sheet
β-strand	19	1	1
α-helix	20	1
α-helix	21-23	3
α-helix	25-27	3
α-helix	30-32	3
β-strand	33	1	1
β-strand	40	1	1
β-strand	44-46	3	2
β-strand	52-54	3	2
α-helix	55-61	7
α-helix	62-64	3
β-strand	67-68	2	3
α-helix	70-74	5
β-strand	84-85	2	3
α-helix	87-89	3
β-strand	91-92	2	2
α-helix	94-101	8
β-strand	104-106	3	4
β-strand	115-117	3	4
α-helix	118-120	3
α-helix	121-125	5
α-helix	130-133	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
TNF receptor-associated factor 2	A	protein	141	Homo sapiens	Q12933 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>3KNV_1 TNF receptor-associated factor 2 (chains A)
MAAASVTPPGSLELLQPGFSKTLLGTKLEAKYLCSACRNVLRRPFQAQCGHRYCSFCLAS
ILSSGPQNCAACVHEGIYEEGISILESSSAFPDNAARREVESLPAVCPSDGCTWKGTLKE
YESCHEGRCPLMLLEHHHHHH

Ligands and cofactors

ID	Name	Formula	Copies
ZN	Zinc ion	Zn	3

Primary citation

Structural basis for the lack of E2 interaction in the RING domain of TRAF2. Yin, Q., Lamothe, B., Darnay, B.G. et al. Biochemistry (2009) 48:10558-10567. DOI 10.1021/bi901462e · PubMed

Other PDB entries of the same protein (UniProt Q12933 (AlphaFold model), which also has an AlphaFold model), best resolution first:

8T5Q 1.9 Å, SARS-CoV-2 ORF3a peptide in complex with TRAF2 TRAF domain
1CZY 2.0 Å, Crystal structure of the complex between the traf domain of human TRAF2 and an LMP1…
1D00 2.0 Å, Structure of tnf receptor associated factor 2 in complex with a 5-residue CD40 peptide
1D01 2.0 Å, Structure of tnf receptor associated factor 2 in complex with a human CD30 peptide
1D0A 2.0 Å, Structure of tnf receptor associated factor 2 (TRAF2) in complex with a human OX40 peptide
1F3V 2.0 Å, Crystal structure of the complex between the N-terminal domain of TRADD and the TRAF…
1CA4 2.2 Å, Structure of tnf receptor associated factor 2 (TRAF2)
1CA9 2.3 Å, Structure of tnf receptor associated factor 2 in complex with a peptide from tnf-R2
1QSC 2.4 Å, Crystal structure of the traf domain of TRAF2 in a complex with a peptide from the CD40…
1D0J 2.5 Å, Structure of tnf receptor associated factor 2 in complex with a M4-1BB peptide
3M0A 2.61 Å, Crystal structure of TRAF2:cIAP2 complex
3M06 2.67 Å, Crystal Structure of TRAF2

Browse structure collections

About this viewer

MolViewer shows 3KNV directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.