3KPH: Mycoplasma arthritidis-derived mitogen

Crystal structure of Mycoplasma arthritidis-derived mitogen. Determined by X-ray diffraction at 2.8 Å resolution. Released 12 May 2010.

Method: X-ray diffraction
Resolution: 2.8 Å
Organism: Mycoplasma arthritidis
Chains: 2
Atoms: 3,336
Mol. weight: 51.43 kDa
Ligands: PO4
Released: 12 May 2010

Explore 3KPH in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3KPH contains 22 α-helices and 0 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chains A and B: 11 helices, 0 β-strands

Element	Residues	Length
α-helix	24-25	2
α-helix	26-34	9
α-helix	40-42	3
α-helix	43-63	21
α-helix	72-91	20
α-helix	97-124	28
α-helix	128-146	19
α-helix	156-167	12
α-helix	171-193	23
α-helix	200-202	3
α-helix	205-211	7

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Superantigen	A, B	protein	217	Mycoplasma arthritidis	Q48898 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>3KPH_1 Superantigen (chains A, B)
GPLGSMKLRVENPKKAQKHFVQNLNNVVFTNKELEDIYNLSNKEETKEVLKLFKLKVNQF
YRHAFGIVNDYNGLLEYKEIFNMMFLKLSVVFDTQRKEANNVEQIKRNIAILDEIMAKAD
NDLSYFISQNKNFQELWDKAVKLTKEMKIKLKGQKLDLRDGEVAINKVRELFGSDKNVKE
LWWFRSLLVKGVYLIKRYYEGDIELATTSDFAKAVFE

Ligands and cofactors

ID	Name	Formula	Copies
PO4	Phosphate ion	O4 P	3

Primary citation

Crystal Structure of the Mycoplasma arthritidis-Derived Mitogen in Apo Form Reveals a 3D Domain-Swapped Dimer. Liu, L., Li, Z., Guo, Y. et al. J Mol Biol (2010) 399:367-376. DOI 10.1016/j.jmb.2010.04.030 · PubMed

Other PDB entries of the same protein (UniProt Q48898 (AlphaFold model), which also has an AlphaFold model), best resolution first:

8VSJ 2.28 Å, Engineered peptide-specific binder in complex with HLA-DR1/CLIP
2ICW 2.41 Å, Crystal structure of a complete ternary complex between TCR, superantigen, and…
1R5I 2.6 Å, Crystal structure of the MAM-MHC complex
2OJE 3.0 Å, Mycoplasma arthritidis-derived mitogen complexed with class II MHC molecule HLA-DR1/HA…

Browse structure collections

About this viewer

MolViewer shows 3KPH directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.