3L0V: PDB entry 3L0V

Crystal structure of catalytic domain of TACE with the first hydantoin inhibitor occupying the S1' pocket. Determined by X-ray diffraction at 1.75 Å resolution. Released 2 Mar 2010.

Method: X-ray diffraction
Resolution: 1.75 Å
Organism: Homo sapiens
Chains: 2
Atoms: 4,288
Mol. weight: 61.85 kDa
Ligands: 724, ZN
Released: 2 Mar 2010

Explore 3L0V in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3L0V contains 27 α-helices and 24 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 14 helices, 10 β-strands

Element	Residues	Length	Sheet
α-helix	220-222	3
β-strand	224-231	8	1
α-helix	233-238	6
α-helix	244-263	20
β-strand	276-284	9	1
α-helix	288-290	3
α-helix	314-324	11
α-helix	326-329	4
β-strand	334-339	6	1
α-helix	344-346	3
β-strand	349-351	3	1
β-strand	368-371	4	2
β-strand	376-379	4	2
β-strand	382-386	5	1
β-strand	388-389	2	3
β-strand	392-393	2	3
α-helix	394-395	2
α-helix	396-410	15
α-helix	415-417	3
α-helix	427-429	3
α-helix	439-440	2
α-helix	445-448	4
α-helix	452-469	18
β-strand	471	1	1

Chain B: 13 helices, 14 β-strands

Element	Residues	Length	Sheet
β-strand	224-231	8	4
α-helix	233-238	6
α-helix	244-263	20
β-strand	276-284	9	4
α-helix	288	1
β-strand	289	1	5
α-helix	290	1
β-strand	300	1	5
α-helix	314-324	11
α-helix	326-329	4
β-strand	334-339	6	4
α-helix	344-346	3
β-strand	349-351	3	4
β-strand	368-371	4	6
β-strand	376-379	4	6
β-strand	382-386	5	4
β-strand	388-389	2	7
β-strand	392-393	2	7
α-helix	394-395	2
α-helix	396-410	15
α-helix	415-417	3
β-strand	421	1	8
β-strand	424	1	8
α-helix	439-440	2
α-helix	445-448	4
α-helix	452-469	18
β-strand	471	1	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Disintegrin and metalloproteinase domain-containing protein 17	A, B	protein	270	Homo sapiens	P78536 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>3L0V_1 Disintegrin and metalloproteinase domain-containing protein 17 (chains A, B)
RADPDPMKNTCKLLVVADHRFYRYMGRGEESTTTNYLIELIDRVDDIYRNTAWDNAGFKG
YGIQIEQIRILKSPQEVKPGEKHYNMAKSYPNEEKDAWDVKMLLEQFSFDIAEEASKVCL
AHLFTYQDFDMGTLGLAYGGSPRANSHGGVCPKAYYSPVGKKNIYLNSGLTSTKNYGKTI
LTKEADLVTTHELGHNFGAEHDPDGLAECAPNEDQGGKYVMYPIAVSGDHENNKMFSQCS
KQSIYKTIESKAQECFQERSNKGSHHHHHH

Ligands and cofactors

ID	Name	Formula	Copies
724	(5R)-5-[(5-methoxy-3-oxo-1,3-dihydro-2H-indazol-2-yl)methyl]-5-methylimidazolid…	C13 H14 N4 O4	2
ZN	Zinc ion	Zn	2

Primary citation

Discovery and SAR of hydantoin TACE inhibitors. Yu, W., Guo, Z., Orth, P. et al. Bioorg Med Chem Lett (2010) 20:1877-1880. DOI 10.1016/j.bmcl.2010.01.148 · PubMed

Other PDB entries of the same protein (UniProt P78536 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2DDF 1.7 Å, Crystal structure of TACE in complex with TAPI-2
8CQY 1.7 Å, Crystal structure of the PTPN3 PDZ domain bound to the PBM TACE C-terminal peptide
3EWJ 1.8 Å, Crystal structure of catalytic domain of TACE with carboxylate inhibitor
3KMC 1.8 Å, Crystal structure of catalytic domain of TACE with tartrate-based inhibitor
3KME 1.85 Å, Crystal structure of catalytic domain of TACE with phenyl-pyrrolidinyl-tartrate inhibitor
3LE9 1.85 Å, Crystal structure of the catalytic domain of TACE with Indazolinone-phenyl-hydantoin…
3O64 1.88 Å, Crystal structure of catalytic domain of TACE with 2-(2-Aminothiazol-4-yl)pyrrolidine-Bas…
2I47 1.9 Å, Crystal structure of catalytic domain of TACE with inhibitor
3E8R 1.9 Å, Crystal structure of catalytic domain of TACE with hydroxamate inhibitor
3EDZ 1.9 Å, Crystal structure of catalytic domain of TACE with hydroxamate inhibitor
3LGP 1.9 Å, Crystal structure of catalytic domain of tace with benzimidazolyl-thienyl-tartrate based…
3L0T 1.92 Å, Crystal structure of catalytic domain of TACE with hydantoin inhibitor

Browse structure collections

About this viewer

MolViewer shows 3L0V directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.