3L3U: HIV-1 integrase core domain to 1.4A

Crystal structure of the HIV-1 integrase core domain to 1.4A. Determined by X-ray diffraction at 1.4 Å resolution. Released 31 Mar 2010.

Method: X-ray diffraction
Resolution: 1.4 Å
Organism: Human immunodeficiency virus 1
Chains: 2
Atoms: 2,840
Mol. weight: 35.89 kDa
Released: 31 Mar 2010

Explore 3L3U in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3L3U contains 18 α-helices and 12 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 9 helices, 7 β-strands

Element	Residues	Length	Sheet
β-strand	60-68	9	1
β-strand	71-78	8	1
β-strand	84-89	6	1
α-helix	94-107	14
β-strand	112-115	4	1
α-helix	119-122	4
α-helix	124-133	10
α-helix	135	1
β-strand	136-139	4	1
α-helix	141-143	3
α-helix	154-165	12
α-helix	166-168	3
α-helix	172-185	14
β-strand	187-188	2	2
β-strand	194-195	2	2
α-helix	196-204	9

Chain B: 9 helices, 5 β-strands

Element	Residues	Length	Sheet
β-strand	60-68	9	3
β-strand	71-78	8	3
β-strand	84-89	6	3
α-helix	94-107	14
β-strand	112-114	3	3
α-helix	119-121	3
α-helix	124-133	10
α-helix	135	1
β-strand	136-138	3	3
α-helix	150-165	16
α-helix	166-168	3
α-helix	172-185	14
α-helix	187-188	2
α-helix	196-208	13

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
POL polyprotein	A, B	protein	163	Human immunodeficiency virus 1	P12497

Sequence of entity 1 (A, B), FASTA

>3L3U_1 POL polyprotein (chains A, B)
MHGQVDSSPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWP
VKTVHTDNGSNFTSTTVKAACDWAGIKQEDGIPYNPQSQGVIESMNKELKKIIGQVRDQA
EHLKTAVQMAVFIHNHKRKGGIGGYSAGERIVDIIATDIQTKE

Primary citation

Crystal structure of the HIV-1 integrase core domain in complex with sucrose reveals details of an allosteric inhibitory binding site. Wielens, J., Headey, S.J., Jeevarajah, D. et al. FEBS Lett (2010) 584:1455-1462. DOI 10.1016/j.febslet.2010.03.016 · PubMed

Other PDB entries of the same protein (UniProt P12497), best resolution first:

3DS4 1.12 Å, HIV-1 capsid C-terminal domain mutant (L211S) in complex with an inhibitor of particle…
3DS2 1.2 Å, HIV-1 capsid C-terminal domain mutant (Y169A)
6T6E 1.3 Å, Crystal Structure of the C-terminal domain of the HIV-1 Integrase (PNL4-3)
2XDE 1.4 Å, Crystal structure of the complex of PF-3450074 with an engineered HIV capsid N terminal…
2PWO 1.45 Å, Crystal Structure of HIV-1 CA146 A92E Psuedo Cell
3WNF 1.45 Å, Cyclic hexapeptide CKIDNC in complex with HIV-1 integrase
6OYD 1.46 Å, X-ray crystal structure of wild type HIV-1 protease in complex with GRL-004
6MCR 1.48 Å, X-ray crystal structure of wild type HIV-1 protease in complex with GRL-001
2PXR 1.5 Å, Crystal Structure of HIV-1 CA146 in the Presence of CAP-1
3WNH 1.5 Å, Cyclic hexapeptide PKZDNv in complex with HIV-1 integrase
4NX4 1.5 Å, Re-refinement of CAP-1 HIV-CA complex
6MCS 1.52 Å, X-ray crystal structure of wild type HIV-1 protease in complex with GRL-003

Browse structure collections

About this viewer

MolViewer shows 3L3U directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.