3L6X: P120 catenin

Name: PDB 3L6X: Crystal structure of p120 catenin in complex with E-cadherin
Published: 2010-04-21
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: cell adhesion

Crystal structure of p120 catenin in complex with E-cadherin. Determined by X-ray diffraction at 2.4 Å resolution. Released 21 Apr 2010.

Method: X-ray diffraction
Resolution: 2.4 Å
Organism: Homo sapiens
Chains: 2
Atoms: 3,664
Mol. weight: 67.75 kDa
Released: 21 Apr 2010

Explore 3L6X in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3L6X contains 35 α-helices and 0 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 34 helices, 0 β-strands

Element	Residues	Length
α-helix	368-374	7
α-helix	380-394	15
α-helix	398-406	9
α-helix	409-415	7
α-helix	416-418	3
α-helix	422-435	14
α-helix	441-449	9
α-helix	452-462	11
α-helix	466-479	14
α-helix	483-485	3
α-helix	486-492	7
α-helix	494-496	3
α-helix	497-502	6
α-helix	503-506	4
α-helix	524-537	14
α-helix	542-550	9
α-helix	554-567	14
α-helix	574-587	14
α-helix	590-593	4
α-helix	649-654	6
α-helix	656-668	13
α-helix	672-686	15
α-helix	691-700	10
α-helix	703-711	9
α-helix	712-714	3
α-helix	718-732	15
α-helix	738-751	14
α-helix	760-762	3
α-helix	766-780	15
α-helix	784-792	9
α-helix	795-803	9
α-helix	810-824	15
α-helix	827-834	8
α-helix	840-843	4

Chain B: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	771-773	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Catenin delta-1	A	protein	584	Homo sapiens	O60716 (AlphaFold model)
E-cadherin	B	protein	18		P12830 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>3L6X_1 Catenin delta-1 (chains A)
GSPEFMIGEEVPSDQYYWAPLAQHERGSLASLDSLRKGGPPPPNWRQPELPEVIAMLGFR
LDAVKSNAAAYLQHLCYRNDKVKTDVRKLKGIPVLVGLLDHPKKEVHLGACGALKNISFG
RDQDNKIAIKNCDGVPALVRLLRKARDMDLTEVITGTLWNLSSHDSIKMEIVDHALHALT
DEVIIPHSGWEREPNEDCKPRHIEWESVLTNTAGCLRNVSSERSEARRKLRECDGLVDAL
IFIVQAEIGQKDSDSKLVENCVCLLRNLSYQVHREIPQAERYQEAAPNVANNTGTSPARG
YELLFQPEVVRIYISLLKESKTPAILEASAGAIQNLCAGRWTYGRYIRSALRQEKALSAI
ADLLTNEHERVVKAASGALRNLAVDARNKELIGKHAIPNLVKNLPGGQQNSSWNFSEDTV
ISILNTINEVIAENLEAAKKLRETQGIEKLVLINKSGNRSEKEVRAAALVLQTIWGYKEL
RKPLEKEGWKKSDFQVNLNNASRSQSSHSYDDSTLPLIDRNQKSDKKPDREEIQMSNMGS
NTKSLDNNYSTPNERGDHNRTLDRSGDLGDMEPLKGTTPLMQKI

Sequence of entity 2 (B), FASTA

>3L6X_2 E-cadherin (chains B)
DEEGGGEEDQDFDLSQLH

Primary citation

Dynamic and static interactions between p120 catenin and E-cadherin regulate the stability of cell-cell adhesion. Ishiyama, N., Lee, S.H., Liu, S. et al. Cell (2010) 141:117-128. DOI 10.1016/j.cell.2010.01.017 · PubMed

Other PDB entries of the same protein (UniProt O60716 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3L6Y 3.0 Å, Crystal structure of p120 catenin in complex with E-cadherin

Browse structure collections

About this viewer

MolViewer shows 3L6X directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.