3LCA: Tom71

Structure of Tom71 complexed with Hsp70 Ssa1 C terminal tail indicating conformational plasticity. Determined by X-ray diffraction at 2.19 Å resolution. Released 22 Dec 2010.

Method: X-ray diffraction
Resolution: 2.19 Å
Organism: Saccharomyces cerevisiae
Chains: 2
Atoms: 4,147
Mol. weight: 61.61 kDa
Released: 22 Dec 2010

Explore 3LCA in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3LCA contains 27 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 27 helices, 0 β-strands

Element	Residues	Length
α-helix	125-139	15
α-helix	143-154	12
α-helix	161-174	14
α-helix	177-190	14
α-helix	195-207	13
α-helix	211-223	13
α-helix	233-252	20
α-helix	266-273	8
α-helix	278-283	6
α-helix	295-306	12
α-helix	310-329	20
α-helix	340-357	18
α-helix	361-374	14
α-helix	378-387	10
α-helix	395-407	13
α-helix	412-424	13
α-helix	428-441	14
α-helix	446-458	13
α-helix	462-475	14
α-helix	481-493	13
α-helix	496-512	17
α-helix	521-533	13
α-helix	543-559	17
α-helix	564-576	13
α-helix	580-593	14
α-helix	597-617	21
α-helix	620-636	17

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Protein TOM71	A	protein	533	Saccharomyces cerevisiae	P38825 (AlphaFold model)
Heat shock protein SSA1	Q	protein	12	Saccharomyces cerevisiae	P10591 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>3LCA_1 Protein TOM71 (chains A)
NGEPDIAQLKGLSPSQRQAYAVQLKNRGNHFFTAKNFNEAIKYYQYAIELDPNEPVFYSN
ISACYISTGDLEKVIEFTTKALEIKPDHSKALLRRASANESLGNFTDAMFDLSVLSLNGD
FDGASIEPMLERNLNKQAMKVLNENLSKDEGRGSQVLPSNTSLASFFGIFDSHLEVSSVN
TSSNYDTAYALLSDALQRLYSATDEGYLVANDLLTKSTDMYHSLLSANTVDDPLRENAAL
ALCYTGIFHFLKNNLLDAQVLLQESINLHPTPNSYIFLALTLADKENSQEFFKFFQKAVD
LNPEYPPTYYHRGQMYFILQDYKNAKEDFQKAQSLNPENVYPYIQLACLLYKQGKFTESE
AFFNETKLKFPTLPEVPTFFAEILTDRGDFDTAIKQYDIAKRLEEVQEKIHVGIGPLIGK
ATILARQSSQDPTQLDEEKFNAAIKLLTKACELDPRSEQAKIGLAQLKLQMEKIDEAIEL
FEDSAILARTMDEKLQATTFAEAAKIQKRLRADPIISAKMELTLARYRAKGML

Sequence of entity 2 (Q), FASTA

>3LCA_2 Heat shock protein SSA1 (chains Q)
PEAEGPTVEEVD

Primary citation

The structural plasticity of Tom71 for mitochondrial precursor translocations. Li, J., Cui, W., Sha, B. Acta Crystallogr Sect F Struct Biol Cryst Commun (2010) 66:985-989. DOI 10.1107/S1744309110025522 · PubMed

Other PDB entries of the same protein (UniProt P38825 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3FP2 1.98 Å, Crystal structure of Tom71 complexed with Hsp82 C-terminal fragment
3FP3 1.98 Å, Crystal structure of Tom71
3FP4 2.14 Å, Crystal structure of Tom71 complexed with Ssa1 C-terminal fragment

Browse structure collections

About this viewer

MolViewer shows 3LCA directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.