3LRE: Kinesin-like protein KIF18A

Crystal Structure Analysis of Human Kinesin-8 Motor Domain. Determined by X-ray diffraction at 2.2 Å resolution. Released 10 Nov 2010.

Method: X-ray diffraction
Resolution: 2.2 Å
Organism: Homo sapiens
Chains: 2
Atoms: 4,911
Mol. weight: 80.48 kDa
Ligands: MG, ADP
Released: 10 Nov 2010

Explore 3LRE in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3LRE contains 32 α-helices and 40 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 16 helices, 23 β-strands

Element	Residues	Length	Sheet
β-strand	13-18	6	1
α-helix	19-21	3
α-helix	23-27	5
α-helix	30-31	2
β-strand	32	1	2
β-strand	34-36	3	3
β-strand	41-44	4	3
β-strand	72-75	4	3
β-strand	78-80	3	1
α-helix	86-91	6
α-helix	94-101	8
β-strand	107-112	6	1
α-helix	119-123	5
β-strand	125	1	4
β-strand	130	1	4
α-helix	132-146	15
β-strand	151-163	13	1
β-strand	166-169	4	1
β-strand	177	1	1
β-strand	178-181	4	5
β-strand	187-190	4	5
β-strand	195	1	1
α-helix	200-212	13
α-helix	215	1
β-strand	216	1	6
β-strand	224	1	6
β-strand	229-240	12	1
α-helix	250-251	2
β-strand	252-258	7	1
α-helix	259-261	3
α-helix	283-295	13
α-helix	307-309	3
α-helix	311-315	5
β-strand	322	1	7
β-strand	324	1	7
β-strand	325-332	8	1
β-strand	335	1	2
α-helix	336-338	3
α-helix	339-351	13

Chain B: 16 helices, 17 β-strands

Element	Residues	Length	Sheet
β-strand	13-18	6	8
α-helix	19-21	3
α-helix	23-26	4
α-helix	30-31	2
β-strand	32	1	9
β-strand	34-36	3	10
β-strand	41-44	4	10
β-strand	72-75	4	10
β-strand	78-80	3	8
α-helix	86-91	6
α-helix	94-102	9
β-strand	107-112	6	8
α-helix	119-123	5
β-strand	125	1	11
β-strand	130	1	11
α-helix	132-144	13
β-strand	151-163	13	8
β-strand	166-169	4	8
β-strand	177	1	8
β-strand	195	1	8
α-helix	200-212	13
α-helix	214-217	4
β-strand	228-240	13	8
β-strand	250-258	9	8
α-helix	259-261	3
α-helix	283-297	15
α-helix	307-309	3
α-helix	311-315	5
α-helix	317-320	4
β-strand	325-332	8	8
β-strand	335	1	9
α-helix	336-338	3
α-helix	339-352	14

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Kinesin-like protein KIF18A	A, B	protein	355	Homo sapiens	Q8NI77 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>3LRE_1 Kinesin-like protein KIF18A (chains A, B)
MSVTEEDLCHHMKVVVRVRPENTKEKAAGFHKVVHVVDKHILVFDPKQEEVSFFHGKKTT
NQNVIKKQNKDLKFVFDAVFDETSTQSEVFEHTTKPILRSFLNGYNCTVLAYGATGAGKT
HTMLGSADEPGVMYLTMLHLYKCMDEIKEEKICSTAVSYLEVYNEQIRDLLVNSGPLAVR
EDTQKGVVVHGLTLHQPKSSEEILHLLDNGNKNRTQHPTDMNATSSRSHAVFQIYLRQQD
KTASINQNVRIAKMSLIDLAGSERASTSGAKGTRFVEGTNINRSLLALGNVINALADSKR
KNQHIPYRNSKLTRLLKDSLGGNCQTIMIAAVSPSSVFYDDTYNTLKYANRAKDI

Ligands and cofactors

ID	Name	Formula	Copies
MG	Magnesium ion	Mg	2
ADP	Adenosine-5'-diphosphate	C10 H15 N5 O10 P2	2

Primary citation

Insight into the molecular mechanism of the multitasking kinesin-8 motor. Peters, C., Brejc, K., Belmont, L. et al. EMBO J (2010) 29:3437-3447. DOI 10.1038/emboj.2010.220 · PubMed

Other PDB entries of the same protein (UniProt Q8NI77 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9YMG 2.41 Å, Human KIF18A-DARPin fusion protein bound to AMP-PNP and tubulin
9DI0 3.1 Å, Cryo-EM structure of Kif18A bound to a microtubule
5OGC 4.8 Å, Molecular basis of human kinesin-8 function and inhibition
7RSI 4.9 Å, The cryo-EM map of KIF18A bound to KIFBP
5OCU 5.2 Å, Molecular basis of human kinesin-8 function and inhibition
5OAM 5.5 Å, Molecular basis of human kinesin-8 function and inhibition

Browse structure collections

About this viewer

MolViewer shows 3LRE directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.