3LVA: Green fluorescent protein

Name: PDB 3LVA: Crystal structure of colorless GFP-like protein from Aequorea coerulescens
Published: 2010-03-09
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: fluorescent protein

Crystal structure of colorless GFP-like protein from Aequorea coerulescens. Determined by X-ray diffraction at 1.5 Å resolution. Released 9 Mar 2010.

Method: X-ray diffraction
Resolution: 1.5 Å
Organism: Aequorea coerulescens
Chains: 2
Atoms: 4,290
Mol. weight: 54.04 kDa
Released: 9 Mar 2010

Explore 3LVA in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3LVA contains 18 α-helices and 28 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chains A and B: 9 helices, 14 β-strands

Element	Residues	Length	Sheet
α-helix	4-8	5
β-strand	12-22	11	1
β-strand	25-36	12	1
β-strand	41-48	8	1
α-helix	57-60	4
α-helix	69-71	3
β-strand	73	1	1
α-helix	74-75	2
α-helix	76-81	6
α-helix	83-86	4
β-strand	92-100	9	1
β-strand	105-115	11	1
β-strand	118-128	11	1
β-strand	141	1	2
β-strand	148-155	8	1
α-helix	156-158	3
β-strand	160-170	11	1
β-strand	171	1	2
β-strand	176-187	12	1
α-helix	196-197	2
β-strand	199-208	10	1
β-strand	217-227	11	1
α-helix	235-237	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Green fluorescent protein	A, B	protein	236	Aequorea coerulescens	Q6YGZ0 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>3LVA_1 Green fluorescent protein (chains A, B)
MSKGAELFTGIVPILIELNGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTL
VTTLXVQCFSRYPDHMKQHDFFKSAMPEGYIQERTIFFEDDGNYKSRAEVKFEGDTLVNR
IELTGTDFKEDGNILGNKMEYNYNAHNVYIMTDKAKNGIKVNFKIRHNIEDGSVQLADHY
QQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMIYFGFVTAAAITHGMDELYK

Primary citation

Structural evidence for a dehydrated intermediate in green fluorescent protein chromophore biosynthesis. Pletneva, N.V., Pletnev, V.Z., Lukyanov, K.A. et al. J Biol Chem (2010) 285:15978-15984. DOI 10.1074/jbc.M109.092320 · PubMed

Other PDB entries of the same protein (UniProt Q6YGZ0 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3LVC 1.14 Å, Crystal structure of GFP-like protein aceGFP_G222E (A. coerulescens). Colorless form.
3LVD 1.75 Å, Crystal structure of GFP-like protein aceGFP_G222E (A. coerulescens). UV-photoconverted…
9UAQ 2.29 Å, CryoEM structure of GFP-like protein from Aequorea coerulescens with Trimbody

Browse structure collections

About this viewer

MolViewer shows 3LVA directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.