Crystal structure of GFP-like protein aceGFP_G222E (A. coerulescens). UV-photoconverted green form. Determined by X-ray diffraction at 1.75 Å resolution. Released 9 Mar 2010.
Explore 3LVD in 3D Show helices and sheets RCSB PDB PDBe
3LVD contains 14 α-helices and 28 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 4-8 | 5 | |
| β-strand | 11-22 | 12 | 1 |
| β-strand | 25-36 | 12 | 1 |
| β-strand | 41-48 | 8 | 1 |
| α-helix | 57-60 | 4 | |
| α-helix | 69-71 | 3 | |
| β-strand | 73 | 1 | 1 |
| α-helix | 76-81 | 6 | |
| α-helix | 83-86 | 4 | |
| β-strand | 92-100 | 9 | 1 |
| β-strand | 105-115 | 11 | 1 |
| β-strand | 118-128 | 11 | 1 |
| β-strand | 141 | 1 | 2 |
| β-strand | 148-155 | 8 | 1 |
| α-helix | 156-158 | 3 | |
| β-strand | 160-170 | 11 | 1 |
| β-strand | 171 | 1 | 2 |
| β-strand | 176-187 | 12 | 1 |
| α-helix | 196-197 | 2 | |
| β-strand | 199-208 | 10 | 1 |
| β-strand | 217-228 | 12 | 1 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 4-8 | 5 | |
| β-strand | 12-22 | 11 | 3 |
| β-strand | 25-36 | 12 | 3 |
| β-strand | 41-48 | 8 | 3 |
| α-helix | 57-60 | 4 | |
| α-helix | 69-71 | 3 | |
| β-strand | 73 | 1 | 3 |
| α-helix | 76-81 | 6 | |
| α-helix | 83-86 | 4 | |
| β-strand | 92-100 | 9 | 3 |
| β-strand | 105-115 | 11 | 3 |
| β-strand | 118-128 | 11 | 3 |
| β-strand | 141 | 1 | 4 |
| β-strand | 148-155 | 8 | 3 |
| α-helix | 156-158 | 3 | |
| β-strand | 160-170 | 11 | 3 |
| β-strand | 171 | 1 | 4 |
| β-strand | 176-187 | 12 | 3 |
| α-helix | 196-197 | 2 | |
| β-strand | 199-208 | 10 | 3 |
| β-strand | 217-228 | 12 | 3 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Green fluorescent protein | A, B | protein | 236 | Aequorea coerulescens | Q6YGZ0 (AlphaFold model) |
>3LVD_1 Green fluorescent protein (chains A, B) MSKGAELFTGIVPILIELNGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTL VTTLXVQCFSRYPDHMKQHDFFKSAMPEGYIQERTIFFEDDGNYKSRAEVKFEGDTLVNR IELTGTDFKEDGNILGNKMEYNYNAHNVYIMTDKAKNGIKVNFKIRHNIEDGSVQLADHY QQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMIYFEFVTAAAITHGMDELYK
Structural evidence for a dehydrated intermediate in green fluorescent protein chromophore biosynthesis. Pletneva, N.V., Pletnev, V.Z., Lukyanov, K.A. et al. J Biol Chem (2010) 285:15978-15984. DOI 10.1074/jbc.M109.092320 · PubMed
Other PDB entries of the same protein (UniProt Q6YGZ0 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 3LVD directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.