3LX7: Novel Tudor domain-containing protein SGF29

Crystal structure of a Novel Tudor domain-containing protein SGF29. Determined by X-ray diffraction at 1.78 Å resolution. Released 5 May 2010.

Method: X-ray diffraction
Resolution: 1.78 Å
Organism: Homo sapiens
Chains: 1
Atoms: 1,176
Mol. weight: 19.85 kDa
Released: 5 May 2010

Explore 3LX7 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3LX7 contains 11 α-helices and 14 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 11 helices, 14 β-strands

Element	Residues	Length	Sheet
α-helix	141-142	2
β-strand	145	1	1
α-helix	149-151	3
α-helix	156-157	2
β-strand	161-165	5	2
β-strand	175-184	10	2
β-strand	189-194	6	2
β-strand	202-206	5	2
α-helix	207-209	3
β-strand	210-212	3	2
α-helix	213-214	2
β-strand	216	1	1
α-helix	224-226	3
α-helix	228-229	2
β-strand	233-237	5	2
α-helix	238	1
β-strand	243-251	9	2
α-helix	258-259	2
β-strand	260-264	5	2
β-strand	265	1	3
β-strand	273	1	3
α-helix	274-276	3
β-strand	277-279	3	2
α-helix	281-283	3
β-strand	284-286	3	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
SAGA-associated factor 29 homolog	A	protein	174	Homo sapiens	Q96ES7 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>3LX7_1 SAGA-associated factor 29 homolog (chains A)
MHHHHHHSSGRENLYFQGGDKPPPLCGAIPASGDYVARPGDKVAARVKAVDGDEQWILAE
VVSYSHATNKYEVDDIDEEGKERHTLSRRRVIPLPQWKANPETDPEALFQKEQLVLALYP
QTTCFYRALIHAPPQRPQDDYSVLFEDTSYADGYSPPLNVAQRYVVACKEPKKK

Primary citation

Sgf29 binds histone H3K4me2/3 and is required for SAGA complex recruitment and histone H3 acetylation. Bian, C., Xu, C., Ruan, J. et al. EMBO J (2011) 30:2829-2842. DOI 10.1038/emboj.2011.193 · PubMed

Other PDB entries of the same protein (UniProt Q96ES7 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3MEA 1.26 Å, Crystal structure of the SGF29 in complex with H3K4me3
3MEU 1.28 Å, Crystal structure of SGF29 in complex with H3R2me2sK4me3
3ME9 1.37 Å, Crystal structure of SGF29 in complex with H3K4me3 peptide
5C0M 1.6 Å, Crystal structure of SGF29 tandem tudor domain in complex with a Carba containing peptide
3MEV 1.83 Å, Crystal structure of SGF29 in complex with R2AK4me3
3MEW 1.92 Å, Crystal structure of Novel Tudor domain-containing protein SGF29
3MET 2.0 Å, Crystal structure of SGF29 in complex with H3K4me2

Browse structure collections

About this viewer

MolViewer shows 3LX7 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.