Crystallographic and Single Crystal Spectral Analysis of the Peroxidase Ferryl Intermediate. Determined by X-ray diffraction at 1.4 Å resolution. Released 12 May 2010.
Explore 3M23 in 3D Show helices and sheets RCSB PDB PDBe
3M23 contains 24 α-helices and 11 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 6-7 | 2 | 1 |
| α-helix | 10-11 | 2 | |
| α-helix | 16-32 | 17 | |
| α-helix | 36-39 | 4 | |
| α-helix | 43-54 | 12 | |
| β-strand | 58 | 1 | 2 |
| β-strand | 63 | 1 | 2 |
| α-helix | 70-72 | 3 | |
| α-helix | 74-77 | 4 | |
| α-helix | 80-82 | 3 | |
| α-helix | 86-98 | 13 | |
| α-helix | 104-118 | 15 | |
| β-strand | 126 | 1 | 3 |
| α-helix | 135-137 | 3 | |
| α-helix | 138-140 | 3 | |
| α-helix | 145-146 | 2 | |
| α-helix | 151-159 | 9 | |
| α-helix | 165-172 | 8 | |
| α-helix | 173-176 | 4 | |
| β-strand | 179-180 | 2 | 4 |
| α-helix | 182-185 | 4 | |
| β-strand | 189-190 | 2 | 4 |
| α-helix | 201-208 | 8 | |
| β-strand | 212-215 | 4 | 5 |
| β-strand | 221-224 | 4 | 5 |
| β-strand | 230-231 | 2 | 5 |
| α-helix | 233-240 | 8 | |
| α-helix | 242-252 | 11 | |
| α-helix | 255-271 | 17 | |
| β-strand | 274-275 | 2 | 1 |
| α-helix | 276-277 | 2 | |
| α-helix | 281-283 | 3 | |
| β-strand | 284 | 1 | 3 |
| α-helix | 286-288 | 3 | |
| α-helix | 289-292 | 4 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Cytochrome c peroxidase, mitochondrial | A | protein | 291 | Saccharomyces cerevisiae | P00431 (AlphaFold model) |
>3M23_1 Cytochrome c peroxidase, mitochondrial (chains A) LVHVASVEKGRSYEDFQKVYNAIALKLREDDEYDNYIGYGPVLVRLAWHTSGTWDKHDNT GGSYGGTYRFKKEFNDPSNAGLQNGFKFLEPIHKEFPWISSGDLFSLGGVTAVQEMQGPK IPWRCGRVDTPEDTTPDNGRLPDADKDADYVRTFFQRLNMNDREVVALMGAHALGKTHLK RSGYEGPWGAANNVFTNEFYLNLLNEDWKLEKNDANNEQWDSKSGYMMLPTDYSLIQDPK YLSIVKEYANDQDKFFKDFSKAFEKLLENGITFPKDAPSPFIFKTLEEQGL
Crystallographic and single-crystal spectral analysis of the peroxidase ferryl intermediate. Meharenna, Y.T., Doukov, T., Li, H. et al. Biochemistry (2010) 49:2984-2986. DOI 10.1021/bi100238r · PubMed
Other PDB entries of the same protein (UniProt P00431 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 3M23 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.