3M4D: M113N mutant of alpha-hemolysin

Crystal structure of the M113N mutant of alpha-hemolysin. Determined by X-ray diffraction at 1.9 Å resolution. Released 5 May 2010.

Method: X-ray diffraction
Resolution: 1.9 Å
Organism: Staphylococcus aureus
Chains: 7
Atoms: 16,762
Mol. weight: 232.91 kDa
Released: 5 May 2010

Explore 3M4D in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3M4D contains 40 α-helices and 171 β-strands across 7 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chains A and C: 6 helices, 24 β-strands

Element	Residues	Length	Sheet
α-helix	2-5	4
β-strand	7	1	1
β-strand	14	1	2
β-strand	21-29	9	3
β-strand	34-43	10	3
β-strand	48	1	4
β-strand	51-61	11	3
β-strand	66-69	4	5
β-strand	75-89	15	5
β-strand	97-102	6	3
α-helix	105-108	4
β-strand	109-127	19	6
β-strand	132-151	20	6
β-strand	153-157	5	5
β-strand	164-171	8	5
β-strand	174-176	3	7
β-strand	179-182	4	7
β-strand	188	1	5
β-strand	192	1	5
β-strand	197	1	8
α-helix	206-208	3
β-strand	210	1	8
α-helix	211-212	2
α-helix	213-215	3
α-helix	218-221	4
β-strand	224	1	3
β-strand	228-234	7	3
β-strand	242-260	19	5
β-strand	265-285	21	5
β-strand	290-292	3	5

Chain B: 6 helices, 25 β-strands

Element	Residues	Length	Sheet
α-helix	2-5	4
β-strand	7	1	9
β-strand	14	1	1
β-strand	21-29	9	4
β-strand	34-43	10	4
β-strand	48	1	10
β-strand	51-61	11	4
β-strand	66-70	5	11
β-strand	75-89	15	11
β-strand	97-102	6	4
α-helix	105-108	4
β-strand	109-121	13	6
β-strand	124-125	2	6
β-strand	133-151	19	6
β-strand	153-158	6	11
β-strand	164-171	8	11
β-strand	174-176	3	12
β-strand	179-182	4	12
β-strand	188	1	11
β-strand	192	1	11
β-strand	197	1	13
α-helix	206-208	3
β-strand	210	1	13
α-helix	211-212	2
α-helix	213-215	3
α-helix	218-221	4
β-strand	224	1	4
β-strand	228-234	7	4
β-strand	242-260	19	11
β-strand	265-285	21	11
β-strand	290-292	3	11

Chain D: 6 helices, 24 β-strands

Element	Residues	Length	Sheet
α-helix	2-5	4
β-strand	7	1	19
β-strand	14	1	14
β-strand	21-29	9	15
β-strand	34-43	10	15
β-strand	48	1	20
β-strand	51-61	11	15
β-strand	66-70	5	21
β-strand	75-89	15	21
β-strand	97-102	6	15
α-helix	105-108	4
β-strand	109-127	19	6
β-strand	132-151	20	6
β-strand	153-158	6	21
β-strand	164-171	8	21
β-strand	174-176	3	22
β-strand	179-182	4	22
β-strand	188	1	21
β-strand	192	1	21
β-strand	197	1	23
α-helix	206-208	3
β-strand	210	1	23
α-helix	211-212	2
α-helix	213-215	3
α-helix	218-221	4
β-strand	224	1	15
β-strand	228-234	7	15
β-strand	242-260	19	21
β-strand	265-285	21	21
β-strand	290-292	3	21

Chain E: 6 helices, 24 β-strands

Element	Residues	Length	Sheet
α-helix	2-5	4
β-strand	7	1	24
β-strand	14	1	19
β-strand	21-29	9	20
β-strand	34-43	10	20
β-strand	48	1	25
β-strand	51-61	11	20
β-strand	66-71	6	26
β-strand	75-89	15	26
β-strand	97-102	6	20
α-helix	105-108	4
β-strand	109-126	18	6
β-strand	132-151	20	6
β-strand	153-157	5	26
β-strand	164-171	8	26
β-strand	174-176	3	27
β-strand	179-182	4	27
β-strand	188	1	26
β-strand	192	1	26
β-strand	197	1	28
α-helix	206-208	3
β-strand	210	1	28
α-helix	211-212	2
α-helix	213-215	3
α-helix	218-221	4
β-strand	224	1	20
β-strand	228-234	7	20
β-strand	242-260	19	26
β-strand	265-285	21	26
β-strand	290-292	3	26

Chain F: 5 helices, 26 β-strands

Element	Residues	Length	Sheet
α-helix	2-5	4
β-strand	7	1	29
β-strand	14	1	24
β-strand	21-29	9	25
β-strand	34-43	10	25
β-strand	48	1	30
β-strand	51-57	7	25
β-strand	60-61	2	25
β-strand	66-71	6	31
β-strand	75-89	15	31
β-strand	97-102	6	25
β-strand	109-121	13	6
β-strand	124-127	4	6
β-strand	132-151	20	6
β-strand	153-157	5	31
β-strand	164-171	8	31
β-strand	174-176	3	32
β-strand	179-182	4	32
β-strand	188	1	31
β-strand	192	1	31
β-strand	197	1	33
α-helix	206-208	3
β-strand	210	1	33
α-helix	211-212	2
α-helix	213-215	3
α-helix	218-221	4
β-strand	224	1	25
β-strand	228-234	7	25
β-strand	242-260	19	31
β-strand	265-285	21	31
β-strand	290-292	3	31

Chain G: 5 helices, 24 β-strands

Element	Residues	Length	Sheet
α-helix	2-5	4
β-strand	7	1	2
β-strand	14	1	29
β-strand	21-29	9	30
β-strand	34-43	10	30
β-strand	48	1	3
β-strand	51-61	11	30
β-strand	66-70	5	34
β-strand	75-89	15	34
β-strand	97-102	6	30
α-helix	105-108	4
β-strand	109-127	19	6
β-strand	132-151	20	6
β-strand	153-158	6	34
β-strand	164-171	8	34
β-strand	174-176	3	35
β-strand	179-182	4	35
β-strand	188	1	34
β-strand	192	1	34
β-strand	197	1	36
α-helix	206-208	3
β-strand	210	1	36
α-helix	211-212	2
α-helix	213-215	3
β-strand	224	1	30
β-strand	228-234	7	30
β-strand	242-260	19	34
β-strand	265-285	21	34
β-strand	290-292	3	34

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Alpha-hemolysin	A, B, C, D, E, F, G	protein	293	Staphylococcus aureus	P09616 (AlphaFold model)

Sequence of entity 1 (A, B, C, D, E, F, G), FASTA

>3M4D_1 Alpha-hemolysin (chains A, B, C, D, E, F, G)
ADSDINIKTGTTDIGSNTTVKTGDLVTYDKENGMHKKVFYSFIDDKNHNKKLLVIRTKGT
IAGQYRVYSEEGANKSGLAWPSAFKVQLQLPDNEVAQISDYYPRNSIDTKEYNSTLTYGF
NGNVTGDDTGKIGGLIGANVSIGHTLKYVQPDFKTILESPTDKKVGWKVIFNNMVNQNWG
PYDRDSWNPVYGNQLFMKTRNGSMKAADNFLDPNKASSLLSSGFSPDFATVITMDRKASK
QQTNIDVIYERVRDDYQLHWTSTNWKGTNTKDKWTDRSSERYKIDWEKEEMTN

Primary citation

Molecular bases of cyclodextrin adapter interactions with engineered protein nanopores. Banerjee, A., Mikhailova, E., Cheley, S. et al. Proc Natl Acad Sci U S A (2010) 107:8165-8170. DOI 10.1073/pnas.0914229107 · PubMed

Other PDB entries of the same protein (UniProt P09616 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7AHL 1.89 Å, Alpha-hemolysin from staphylococcus aureus
3M2L 2.1 Å, Crystal structure of the M113F mutant of alpha-hemolysin
3M3R 2.2 Å, Crystal structure of the M113F alpha-hemolysin mutant complexed with beta-cyclodextrin
8JX2 2.2 Å, alpha-Hemolysin(G122S/K147R)-SpyTag/SpyCatcher head to head 14-mer
8JX3 2.2 Å, alpha-Hemolysin(G122S/K147R/K237C)-SpyTag/SpyCatcher head to head 14-mer
3M4E 2.3 Å, Crystal structure of the M113N mutant of alpha-hemolysin bound to beta-cyclodextrin
6U49 2.35 Å, Structure-based discovery of a novel small-molecule inhibitor of methicillin-resistant…
9SVZ 2.4 Å, The structure of S. aureus alpha-hemolysin in complex with a bicyclic peptide inhibitor
6U4P 2.49 Å, Structure-based discovery of a novel small-molecule inhibitor of methicillin-resistant…
6U3T 2.79 Å, Structure-based discovery of a novel small-molecule inhibitor of methicillin-resistant…
4YHD 2.8 Å, Staphylococcal alpha-hemolysin H35A mutant monomer
9M4P 3.1 Å, Cryo-EM structure of alpha-hemolysin heptameric pore state in the presence of RBC

Browse structure collections

About this viewer

MolViewer shows 3M4D directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.