3M93: Translation initiation factor 4E

Name: PDB 3M93: Complex crystal structure of Ascaris suum eIF4E-3 with m7G cap
Published: 2011-07-20
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: translation

Complex crystal structure of Ascaris suum eIF4E-3 with m7G cap. Determined by X-ray diffraction at 2.9 Å resolution. Released 20 Jul 2011.

Method: X-ray diffraction
Resolution: 2.9 Å
Organisms: Ascaris suum, Homo sapiens
Chains: 2
Atoms: 1,572
Mol. weight: 24.77 kDa
Ligands: M7G
Released: 20 Jul 2011

Explore 3M93 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3M93 contains 10 α-helices and 8 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 9 helices, 8 β-strands

Element	Residues	Length	Sheet
α-helix	49-50	2
β-strand	51-61	11	1
α-helix	70-72	3
β-strand	73-81	9	1
α-helix	82-91	10
α-helix	93-94	2
α-helix	98-99	2
β-strand	103-108	6	1
β-strand	124-130	7	1
α-helix	131	1
α-helix	135-151	17
α-helix	156-161	6
β-strand	162-168	7	1
β-strand	174-180	7	1
α-helix	186-200	15
β-strand	208-212	5	1
β-strand	228-230	3	1

Chain C: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	6-11	6

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Translation initiation factor 4E	A	protein	189	Ascaris suum	Q6PKX2 (AlphaFold model)
Eukaryotic translation initiation factor 4E-binding protein 1	C	protein	17	Homo sapiens	Q13541 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>3M93_1 Translation initiation factor 4E (chains A)
MRHPLQCHWALWYLKADRSKDWEDCLKQVAVFDTVEDFWSLYNHIQAASGLTWGSDYYLF
KEGIKPMWEDENNVKGGRWLVVVDKQKRAQLLDHYWLELLMAIIGEQFEDNGEYICGAVV
NVRQKGDKVSLWTRDSLKDDVNLRIGQILKAKLEIPDTEPIRYEVHKDSSVRTGSMVKPR
IVIPSKDNR

Sequence of entity 2 (C), FASTA

>3M93_2 Eukaryotic translation initiation factor 4E-binding protein 1 (chains C)
RIIYDRKFLMECRNSPV

Ligands and cofactors

ID	Name	Formula	Copies
M7G	7N-methyl-8-hydroguanosine-5'-diphosphate	C11 H18 N5 O11 P2	1

Primary citation

Structural basis for nematode eIF4E binding an m2,2,7G-Cap and its implications for translation initiation. Liu, W., Jankowska-Anyszka, M., Piecyk, K. et al. Nucleic Acids Res (2011) 39:8820-8832. DOI 10.1093/nar/gkr650 · PubMed

Other PDB entries of the same protein (UniProt Q6PKX2 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3M94 2.05 Å, Complex crystal structure of Ascaris suum eIF4E-3 with m2,2,7G cap

Browse structure collections

About this viewer

MolViewer shows 3M93 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.