3MH7: Protease do

HtrA proteases are activated by a conserved mechanism that can be triggered by distinct molecular cues. Determined by X-ray diffraction at 2.96 Å resolution. Released 30 Jun 2010.

Method: X-ray diffraction
Resolution: 2.96 Å
Organism: Escherichia coli
Chains: 3
Atoms: 2,919
Mol. weight: 49.47 kDa
Released: 30 Jun 2010

Explore 3MH7 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3MH7 contains 15 α-helices and 35 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 15 helices, 33 β-strands

Element	Residues	Length	Sheet
α-helix	16-22	7
α-helix	23-25	3
β-strand	26-34	9	1
β-strand	83-94	12	1
β-strand	99-103	5	1
α-helix	104-107	4
β-strand	110-116	7	1
β-strand	122-131	10	1
β-strand	136-141	6	1
α-helix	149-151	3
β-strand	152	1	2
α-helix	153	1
α-helix	155-157	3
β-strand	163-168	6	2
α-helix	170-172	3
β-strand	176-187	12	2
β-strand	198-201	4	2
β-strand	213-215	3	2
β-strand	221-229	9	2
α-helix	231-233	3
β-strand	239-243	5	2
α-helix	244-257	14
β-strand	262	1	3
β-strand	264	1	4
β-strand	267-271	5	5
α-helix	274-279	6
β-strand	288-293	6	5
α-helix	298-302	5
β-strand	309-313	5	5
β-strand	316-317	2	5
α-helix	321-328	8
β-strand	332	1	3
β-strand	336-343	8	5
β-strand	346-353	8	5
β-strand	355	1	4
β-strand	363	1	6
α-helix	364-368	5
β-strand	375-377	3	6
β-strand	379	1	7
β-strand	382	1	7
β-strand	385-389	5	6
α-helix	397-399	3
β-strand	406-407	2	6
β-strand	409-410	2	8
β-strand	413-414	2	8
α-helix	418-426	9
β-strand	433-438	6	8
β-strand	441-446	6	8

Chain B: 0 helices, 1 β-strand

Element	Residues	Length	Sheet
β-strand	103-105	3	2

Chain C: 0 helices, 1 β-strand

Element	Residues	Length	Sheet
β-strand	505-506	2	5

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Protease do	A	protein	456	Escherichia coli	P0C0V0 (AlphaFold model)
5-mer peptide	B, C	protein	5	Escherichia coli

Sequence of entity 1 (A), FASTA

>3MH7_1 Protease do (chains A)
AETSSATTAQQMPSLAPMLEKVMPSVVSINVEGSTTVNTPRMPRNFQQFFGDDSPFCQEG
SPFQSSPFCQGGQGGNGGGQQQKFMALGSGVIIDADKGYVVTNNHVVDNATVIKVQLSDG
RKFDAKMVGKDPRSDIALIQIQNPKNLTAIKMADSDALRVGDYTVAIGNPFGLGETVTSG
IVSALGRSGLNAENYENFIQTDAAINRGNAGGALVNLNGELIGINTAILAPDGGNIGIGF
AIPSNMVKNLTSQMVEYGQVKRGELGIMGTELNSELAKAMKVDAQRGAFVSQVLPNSSAA
KAGIKAGDVITSLNGKPISSFAALRAQVGTMPVGSKLTLGLLRDGKQVNVNLELQQSSQN
QVDSSSIFNGIEGAEMSNKGKDQGVVVNNVKTGTPAAQIGLKKGDVIIGANQQAVKNIAE
LRKVLDSKPSVLALNIQRGDSTIYLLMQRSHHHHHH

Sequence of entity 2 (B, C), FASTA

>3MH7_2 5-mer peptide (chains B, C)
XXXXX

Primary citation

HtrA proteases have a conserved activation mechanism that can be triggered by distinct molecular cues. Krojer, T., Sawa, J., Huber, R. et al. Nat Struct Mol Biol (2010) 17:844-852. DOI 10.1038/nsmb.1840 · PubMed

Other PDB entries of the same protein (UniProt P0C0V0 (AlphaFold model), which also has an AlphaFold model), best resolution first:

8F0A 2.6 Å, Client-bound structure of a DegP trimer within a 12mer cage
1KY9 2.8 Å, Crystal Structure of DegP (HtrA)
3CS0 3.0 Å, Crystal structure of DegP24
3MH5 3.0 Å, HtrA proteases are activated by a conserved mechanism that can be triggered by distinct…
3OU0 3.0 Å, re-refined 3CS0
3MH4 3.1 Å, HtrA proteases are activated by a conserved mechanism that can be triggered by distinct…
8F0U 3.1 Å, Structure of a 12mer DegP cage bound to the client protein hTRF1
3MH6 3.6 Å, HtrA proteases are activated by a conserved mechanism that can be triggered by distinct…
6JJK 3.6 Å, Crystal structure of the DegP dodecamer with a modulator
3OTP 3.76 Å, Crystal structure of the DegP dodecamer with a model substrate
6JJO 4.16 Å, Crystal structure of the DegP dodecamer with a modulator
6JJL 4.2 Å, Crystal structure of the DegP dodecamer with a modulator

Browse structure collections

About this viewer

MolViewer shows 3MH7 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.