3MIA: HIV-1 Tat

Crystal structure of HIV-1 Tat complexed with ATP-bound human P-TEFb. Determined by X-ray diffraction at 3.0 Å resolution. Released 9 Jun 2010.

Method: X-ray diffraction
Resolution: 3.0 Å
Organisms: Homo sapiens, Human immunodeficiency virus type 1
Chains: 3
Atoms: 5,069
Mol. weight: 82.08 kDa
Ligands: ANP, MG, ZN
Released: 9 Jun 2010

Explore 3MIA in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3MIA contains 40 α-helices and 15 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 21 helices, 13 β-strands

Element	Residues	Length	Sheet
β-strand	15	1	1
α-helix	16-18	3
β-strand	19-24	6	1
β-strand	33-38	6	1
β-strand	44-49	6	1
α-helix	61-72	12
β-strand	75	1	2
β-strand	78	1	2
β-strand	81-87	7	1
β-strand	98-104	7	1
β-strand	108-109	2	2
α-helix	110-115	6
α-helix	123-142	20
β-strand	145-146	2	3
α-helix	152-154	3
β-strand	155-157	3	2
β-strand	163-165	3	2
β-strand	172-173	2	3
α-helix	181-183	3
α-helix	192-194	3
α-helix	197-200	4
α-helix	209-224	16
α-helix	234-245	12
α-helix	256-258	3
α-helix	260-262	3
α-helix	275-278	4
α-helix	280-283	4
α-helix	286-295	10
α-helix	300-302	3
α-helix	306-311	6
α-helix	313-315	3
α-helix	320-321	2
α-helix	325-329	5
α-helix	335-339	5

Chain B: 14 helices, 1 β-strand

Element	Residues	Length	Sheet
α-helix	16-20	5
α-helix	25-27	3
α-helix	31-51	21
β-strand	55	1	4
α-helix	56-69	14
α-helix	80-94	15
α-helix	101-112	12
α-helix	124-143	20
α-helix	153-164	12
α-helix	168-184	17
α-helix	187-189	3
α-helix	193-207	15
α-helix	221-224	4
α-helix	231-245	15
α-helix	249-251	3

Chain C: 5 helices, 1 β-strand

Element	Residues	Length	Sheet
α-helix	10-12	3
α-helix	14	1
β-strand	15	1	4
α-helix	21-23	3
α-helix	35-37	3
α-helix	38-42	5

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Cell division protein kinase 9	A	protein	351	Homo sapiens	P50750 (AlphaFold model)
Cyclin-T1	B	protein	266	Homo sapiens	O60563 (AlphaFold model)
Protein Tat	C	protein	86	Human immunodeficiency virus type 1	P04608 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>3MIA_1 Cell division protein kinase 9 (chains A)
MAKQYDSVECPFCDEVSKYEKLAKIGQGTFGEVFKARHRKTGQKVALKKVLMENEKEGFP
ITALREIKILQLLKHENVVNLIEICRTKASPYNRCKGSIYLVFDFCEHDLAGLLSNVLVK
FTLSEIKRVMQMLLNGLYYIHRNKILHRDMKAANVLITRDGVLKLADFGLARAFSLAKNS
QPNRYTNRVVTLWYRPPELLLGERDYGPPIDLWGAGCIMAEMWTRSPIMQGNTEQHQLAL
ISQLCGSITPEVWPNVDNYELYEKLELVKGQKRKVKDRLKAYVRDPYALDLIDKLLVLDP
AQRIDSDDALNHDFFWSDPMPSDLKGMLSTHLTSMFEYLAPPRRKHHHHHH

Sequence of entity 2 (B), FASTA

>3MIA_2 Cyclin-T1 (chains B)
MEGERKNNNKRWYFTREQLENSPSRRFGVDPDKELSYRQQAANLLQDMGQRLNVSQLTIN
TAIVYMHRFYMIQSFTQFPGNSVAPAALFLAAKVEEQPKKLEHVIKVAHTCLHPQESLPD
TRSEAYLQQVQDLVILESIILQTLGFELTIDHPHTHVVKCTQLVRASKDLAQTSYFMATN
SLHLTTFSLQYTPPVVACVCIHLACKWSNWEIPVSTDGKHWWEYVDATVTLELLDELTHE
FLQILEKTPNRLKRIWNWRACEAAKK

Sequence of entity 3 (C), FASTA

>3MIA_3 Protein Tat (chains C)
MEPVDPRLEPWKHPGSQPKTACTNCYCKKCCFHCQVCFITKALGISYGRKKRRQRRRAHQ
NSQTHQASLSKQPTSQSRGDPTGPKE

Ligands and cofactors

ID	Name	Formula	Copies
ANP	Phosphoaminophosphonic acid-adenylate ester	C10 H17 N6 O12 P3	1
MG	Magnesium ion	Mg	1
ZN	Zinc ion	Zn	2

Primary citation

Crystal structure of HIV-1 Tat complexed with human P-TEFb. Tahirov, T.H., Babayeva, N.D., Varzavand, K. et al. Nature (2010) 465:747-751. DOI 10.1038/nature09131 · PubMed

Other PDB entries of the same protein (UniProt P50750 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3MI9 2.1 Å, Crystal structure of HIV-1 Tat complexed with human P-TEFb
3BLH 2.48 Å, Crystal Structure of Human CDK9/cyclinT1
3BLR 2.8 Å, Crystal Structure of Human CDK9/cyclinT1 in complex with Flavopiridol
3MY1 2.8 Å, Structure of CDK9/cyclinT1 in complex with DRB
7NWK 2.81 Å, Crystal structure of CDK9-Cyclin T1 bound by compound 6
3BLQ 2.9 Å, Crystal Structure of Human CDK9/cyclinT1 in Complex with ATP
4OR5 2.9 Å, Crystal structure of HIV-1 Tat complexed with human P-TEFb and AFF4
4IMY 2.94 Å, The AFF4 scaffold binds human P-TEFb adjacent to HIV Tat
3TN8 2.95 Å, CDK9/cyclin T in complex with CAN508
4BCH 2.96 Å, Structure of CDK9 in complex with cyclin T and a 2-amino-4-heteroaryl- pyrimidine…
3LQ5 3.0 Å, Structure of CDK9/CyclinT in complex with S-CR8
4OGR 3.0 Å, crystal structure of P-TEFb complex with AFF4 and Tat

Browse structure collections

About this viewer

MolViewer shows 3MIA directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.