3MP8: Sgf29 tudor domain

Crystal structure of Sgf29 tudor domain. Determined by X-ray diffraction at 1.92 Å resolution. Released 4 May 2011.

Method: X-ray diffraction
Resolution: 1.92 Å
Organisms: Escherichia coli K-12, unidentified, Saccharomyces cerevisiae S288C
Chains: 1
Atoms: 4,591
Mol. weight: 59.71 kDa
Ligands: 4BZ
Released: 4 May 2011

Explore 3MP8 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3MP8 contains 31 α-helices and 36 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 31 helices, 36 β-strands

Element	Residues	Length	Sheet
β-strand	745-748	4	1
α-helix	755-769	15
β-strand	773-776	4	1
α-helix	781-789	9
β-strand	797-801	5	1
α-helix	802-804	3
α-helix	805-810	6
β-strand	814	1	2
α-helix	815-817	3
α-helix	821-824	4
β-strand	827	1	3
α-helix	829-834	6
β-strand	836-837	2	4
β-strand	840-841	2	4
β-strand	844-849	6	1
β-strand	852-856	5	5
β-strand	866	1	6
α-helix	867-869	3
α-helix	870-878	9
β-strand	883-885	3	5
α-helix	892-894	3
α-helix	896-901	6
β-strand	905-910	6	7
β-strand	913-920	8	7
α-helix	924-938	15
α-helix	948-956	9
β-strand	960-965	6	5
α-helix	967-969	3
α-helix	970-976	7
β-strand	980-983	4	5
α-helix	984-986	3
β-strand	987	1	6
β-strand	988	1	8
β-strand	991	1	8
α-helix	995	1
β-strand	996-997	2	9
β-strand	998-1004	7	1
β-strand	1005	1	2
α-helix	1011-1017	7
α-helix	1018-1022	5
α-helix	1025-1034	10
β-strand	1039-1040	2	1
β-strand	1042	1	3
α-helix	1043-1049	7
α-helix	1053-1064	12
β-strand	1066-1067	2	9
α-helix	1068-1069	2
α-helix	1074-1090	17
α-helix	1095-1105	11
β-strand	1111	1	10
β-strand	1125	1	10
β-strand	1130-1133	4	11
β-strand	1144-1153	10	11
β-strand	1158-1163	6	11
β-strand	1174-1179	6	11
α-helix	1180-1182	3
β-strand	1183-1185	3	11
α-helix	1186-1187	2
α-helix	1194-1196	3
β-strand	1200-1204	5	11
α-helix	1205	1
β-strand	1210-1219	10	11
α-helix	1224	1
β-strand	1225-1229	5	11
β-strand	1239-1241	3	11
α-helix	1243-1245	3
β-strand	1246-1248	3	11

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Maltose-binding periplasmic protein,LINKER,SAGA-associated factor 29	A	protein	522	Escherichia coli K-12, unidentified, Saccharomyces cerevisiae S288C	P0AEX9 (AlphaFold model), P25554 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>3MP8_1 Maltose-binding periplasmic protein,LINKER,SAGA-associated factor 29 (chains A)
MKIEEGKLVIWINGDKGYNGLAEVGKKFEKDTGIKVTVEHPDKLEEKFPQVAATGDGPDI
IFWAHDRFGGYAQSGLLAEITPDKAFQDKLYPFTWDAVRYNGKLIAYPIAVEALSLIYNK
DLLPNPPKTWEEIPALDKELKAKGKSALMFNLQEPYFTWPLIAADGGYAFKYENGKYDIK
DVGVDNAGAKAGLTFLVDLIKNKHMNADTDYSIAEAAFNKGETAMTINGPWAWSNIDTSK
VNYGVTVLPTFKGQPSKPFVGVLSAGINAASPNKELAKEFLENYLLTDEGLEAVNKDKPL
GAVALKSYEEELAKDPRIAATMENAQKGEIMPNIPQMSAFWYAVRTAVINAASGRQTVDE
ALAAAQTNAAAEFGSSYWTSEYNPNAPILVGSEVAYKPRRGSADGEWIQCEVLKVVADGT
RFEVRDPEPDELGNSGKVYKCNRKELLLIPPGFPTKNYPPGTKVLARYPETTTFYPAIVI
GTKRDGTCRLRFDGEEEVDKETEVTRRLVLPSPTALANLARK

Ligands and cofactors

ID	Name	Formula	Copies
4BZ	4-(hydroxymethyl)benzamidine	C8 H10 N2 O	1

Water and common crystallization additives (ACY, NA, SO4, GOL) are not listed.

Primary citation

Sgf29 binds histone H3K4me2/3 and is required for SAGA complex recruitment and histone H3 acetylation. Bian, C., Xu, C., Ruan, J. et al. EMBO J (2011) 30:2829-2842. DOI 10.1038/emboj.2011.193 · PubMed

Other PDB entries of the same protein (UniProt P0AEX9 (AlphaFold model), which also has an AlphaFold model), best resolution first:

8C8F 1.15 Å, Crystal structure of the E. coli maltodextrin-binding protein
4EXK 1.28 Å, A chimera protein containing MBP fused to the C-terminal domain of the uncharacterized…
3Q27 1.3 Å, Cyrstal structure of human alpha-synuclein (32-57) fused to maltose binding protein (MBP)
7KD4 1.31 Å, Structure of the C-terminal domain of the Menangle virus phosphoprotein (residues 329…
5M13 1.37 Å, Synthetic nanobody in complex with MBP
5HZ7 1.43 Å, High-resolution crystal structure of the minor DNA-binding pilin ComP from Neisseria…
5H7Q 1.45 Å, Crystal structure of human MNDA PYD domain with MBP tag
6XDS 1.47 Å, Crystal structure of MBP-TREM2 Ig domain fusion with fragment,…
4IRL 1.47 Å, X-ray structure of the CARD domain of zebrafish GBP-NLRP1 like protein
8SVY 1.47 Å, MBP-Mcl1 in complex with ligand 10
3MP6 1.48 Å, Complex Structure of Sgf29 and dimethylated H3K4
9CLC 1.48 Å, Crystal structure of maltose binding protein (Apo), mutant Trp10 to 4-Cyanotryptophan

Browse structure collections

About this viewer

MolViewer shows 3MP8 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.