3MQC: Ectodomain of BST-2/Tetherin/CD317

Crystal Structure of Ectodomain of BST-2/Tetherin/CD317 (P21). Determined by X-ray diffraction at 2.8 Å resolution. Released 27 Oct 2010.

Method: X-ray diffraction
Resolution: 2.8 Å
Organism: Homo sapiens
Chains: 4
Atoms: 3,099
Mol. weight: 54.59 kDa
Released: 27 Oct 2010

Explore 3MQC in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3MQC contains 4 α-helices and 0 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chains A, B, C and D: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	11-108	98

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Bone marrow stromal antigen 2	A, B, C, D	protein	121	Homo sapiens	Q10589 (AlphaFold model)

Sequence of entity 1 (A, B, C, D), FASTA

>3MQC_1 Bone marrow stromal antigen 2 (chains A, B, C, D)
AGFSMDKANSEACRDGLRAVMECRNVTHLLQQELTEAQKGFQDVEAQAATCNHTVMALMA
SLDAEKAQGQKKVEELEGEITTLNHKLQDASAEVERLRRENQVLSVRIADKKYYPSSQDS
S

Primary citation

Structural insight into the mechanisms of enveloped virus tethering by tetherin. Yang, H., Wang, J., Jia, X. et al. Proc Natl Acad Sci U S A (2010) 107:18428-18432. DOI 10.1073/pnas.1011485107 · PubMed

Other PDB entries of the same protein (UniProt Q10589 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7Q9A 2.1 Å, MHC Class I A02 Allele presenting LLLGIGILVL, in complex with Mel5 TCR
3MQ7 2.28 Å, Crystal Structure of Ectodomain Mutant of BST-2/Tetherin/CD317
3NWH 2.6 Å, Crystal structure of BST2/Tetherin
2X7A 2.77 Å, Structural basis of HIV-1 tethering to membranes by the Bst2-tetherin ectodomain
3MQ9 2.8 Å, Crystal Structure of Ectodomain Mutant of BST-2/Tetherin/CD317 Fused to MBP
4P6Z 3.0 Å, Crystal structure of the human BST2 cytoplasmic domain and the HIV-1 Vpu cytoplasmic…
3MQB 3.2 Å, Crystal Structure of Ectodomain of BST-2/Tetherin/CD317 (C2)
2XG7 3.45 Å, Crystal Structure of BST2-Tetherin Ectodomain expressed in HEK293T cells
6CM9 3.73 Å, Structure of the cargo bound AP-1:Arf1:tetherin-Nef closed trimer monomeric subunit
6DFF 3.9 Å, Structure of the cargo bound AP-1:Arf1:tetherin-Nef monomer
6D83 4.27 Å, Structure of the cargo bound AP-1:Arf1:tetherin-Nef (L164A, L165A) dileucine mutant…
6D84 6.72 Å, Structure of the cargo bound AP-1:Arf1:tetherin-Nef (L164A, L165A) dileucine mutant dimer

Browse structure collections

About this viewer

MolViewer shows 3MQC directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.