3N3U: IbpAFic2

Crystal Structure of IbpAFic2. Determined by X-ray diffraction at 1.85 Å resolution. Released 14 Jul 2010.

Method: X-ray diffraction
Resolution: 1.85 Å
Organism: Histophilus somni
Chains: 1
Atoms: 2,504
Mol. weight: 33.8 kDa
Ligands: ZN
Released: 14 Jul 2010

Explore 3N3U in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3N3U contains 20 α-helices and 2 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 20 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	3499-3511	13
α-helix	3513	1
α-helix	3514-3518	5
α-helix	3521-3534	14
α-helix	3539-3543	5
α-helix	3549-3552	4
α-helix	3555-3568	14
α-helix	3574-3585	12
α-helix	3596-3609	14
α-helix	3612-3616	5
α-helix	3618-3635	18
α-helix	3642-3651	10
β-strand	3663	1	1
α-helix	3675-3677	3
α-helix	3678-3697	20
α-helix	3702-3716	15
β-strand	3719	1	1
α-helix	3723-3737	15
α-helix	3740-3743	4
α-helix	3751-3754	4
α-helix	3763-3766	4
α-helix	3767-3779	13

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Adenosine monophosphate-protein transferase ibpA	A	protein	299	Histophilus somni	Q06277

Sequence of entity 1 (A), FASTA

>3N3U_1 Adenosine monophosphate-protein transferase ibpA (chains A)
VNYQDLEDNLNLKGLISLEDDRNANFESNVLKNEKFLDEAREISKKSIPEATVKQMSHLP
EFDDILTEGAKKVESRINKAITFRPSVEEFSEIQDLVKTLPKTKVIEDLSTKTNEITEAL
AATSKTIQRTPELKEQLKTAIEDFLQNSQGKPLTVQMIENLNHGLRPDEGEGRLLYKKEN
LTKENAVFSSPEAAKIQLAETVDFINRAKNEGIEPSVVGALVYQRLIAYHPFAEGNGRMA
RVIVNKILLDAGYPAFTKFSDEFEPQIIPQTKASTKSATSSEVVVEFLKELAKKGSKED

Ligands and cofactors

ID	Name	Formula	Copies
ZN	Zinc ion	Zn	2

Water and common crystallization additives (SO4) are not listed.

Primary citation

Structural basis of Fic-mediated adenylylation. Xiao, J., Worby, C.A., Mattoo, S. et al. Nat Struct Mol Biol (2010) 17:1004-1010. DOI 10.1038/nsmb.1867 · PubMed

Other PDB entries of the same protein (UniProt Q06277), best resolution first:

4ITR 2.3 Å, Crystal Structure of IbpAFic2-H3717A in complex with adenylylated Cdc42
6SIU 2.49 Å, Crystal structure of IbpAFic2 covalently tethered to Cdc42

Browse structure collections

About this viewer

MolViewer shows 3N3U directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.