3NFQ: Conserved central domain of yeast Spn1/Iws1

Name: PDB 3NFQ: Crystal structure of the conserved central domain of yeast Spn1/Iws1
Published: 2010-10-13
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: transcription

Crystal structure of the conserved central domain of yeast Spn1/Iws1. Determined by X-ray diffraction at 1.85 Å resolution. Released 13 Oct 2010.

Method: X-ray diffraction
Resolution: 1.85 Å
Organism: Saccharomyces cerevisiae
Chains: 2
Atoms: 2,718
Mol. weight: 39.37 kDa
Released: 13 Oct 2010

Explore 3NFQ in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3NFQ contains 21 α-helices and 0 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 10 helices, 0 β-strands

Element	Residues	Length
α-helix	10-42	33
α-helix	51-63	13
α-helix	66-68	3
α-helix	69-74	6
α-helix	77-85	9
α-helix	87-88	2
α-helix	96-107	12
α-helix	113-119	7
α-helix	121-130	10
α-helix	136-149	14

Chain B: 11 helices, 0 β-strands

Element	Residues	Length
α-helix	9-42	34
α-helix	51-63	13
α-helix	66-68	3
α-helix	69-74	6
α-helix	77-85	9
α-helix	87-88	2
α-helix	92-95	4
α-helix	96-108	13
α-helix	113-119	7
α-helix	121-130	10
α-helix	136-149	14

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Transcription factor IWS1	A, B	protein	170	Saccharomyces cerevisiae	Q06505 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>3NFQ_1 Transcription factor IWS1 (chains A, B)
RRTRRDEDDLEQYLDEKILRLKDEMNIAAQLDIDTLNKRIETGDTSLIAMQKVKLLPKVV
SVLSKANLADTILDNNLLQSVRIWLEPLPDGSLPSFEIQKSLFAALNDLPVKTEHLKESG
LGRVVIFYTKSKRVEAQLARLAEKLIAEWTRPIIGASDNYRDKRIMQLEF

Primary citation

The Transcription Factor Spn1 Regulates Gene Expression via a Highly Conserved Novel Structural Motif. Pujari, V., Radebaugh, C.A., Chodaparambil, J.V. et al. J Mol Biol (2010) 404:1-15. DOI 10.1016/j.jmb.2010.09.040 · PubMed

Other PDB entries of the same protein (UniProt Q06505 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3O8Z 2.15 Å, Crystal structure of Spn1 (Iws1) core domain
3OAK 2.15 Å, Crystal structure of a Spn1 (Iws1)-Spt6 complex

Browse structure collections

About this viewer

MolViewer shows 3NFQ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.