Crystal structure of the complex of group I phospholipase A2 with 4-Methoxy-benzoicacid at 1.4A resolution. Determined by X-ray diffraction at 1.4 Å resolution. Released 14 Jul 2010.
Explore 3NJU in 3D Show helices and sheets RCSB PDB PDBe
3NJU contains 6 α-helices and 5 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 2-12 | 11 | |
| α-helix | 19-22 | 4 | |
| β-strand | 25 | 1 | 1 |
| β-strand | 29 | 1 | 1 |
| α-helix | 40-55 | 16 | |
| β-strand | 70-73 | 4 | 2 |
| β-strand | 76-79 | 4 | 2 |
| α-helix | 85-103 | 19 | |
| α-helix | 108-110 | 3 | |
| β-strand | 111 | 1 | 1 |
| α-helix | 115-118 | 4 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Phospholipase A2 isoform 3 | A | protein | 119 | Naja sagittifera | P60045 (AlphaFold model) |
>3NJU_1 Phospholipase A2 isoform 3 (chains A) NLYQFKNMIQCTVPSRSWADFADYGCYCGKGGSGTPVDDLDRCCQTHDNCYNEAENISGC RPYFKTYSYECTQGTLTCKGDNNACAASVCDCDRLAAICFAGAPYNDANYNIDLKARCN
Crystal structure of the complex of group I phospholipase A2 with 4-Methoxy-benzoicacid at 1.4A resolution. Kaushik, S., Prem Kumar, R., Sinha, M. et al. To be published.
Other PDB entries of the same protein (UniProt P60045 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 3NJU directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.