3NKU: DrrA

Crystal structure of the N-terminal domain of DrrA/SidM from Legionella pneumophila. Determined by X-ray diffraction at 2.1 Å resolution. Released 4 Aug 2010.

Method: X-ray diffraction
Resolution: 2.1 Å
Organism: Legionella pneumophila subsp. pneumophila
Chains: 2
Atoms: 3,167
Mol. weight: 49.36 kDa
Released: 4 Aug 2010

Explore 3NKU in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3NKU contains 20 α-helices and 10 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 8 helices, 4 β-strands

Element	Residues	Length	Sheet
α-helix	31-53	23
α-helix	55-57	3
α-helix	61-84	24
α-helix	87-89	3
β-strand	93-97	5	1
β-strand	112-116	5	1
α-helix	121-143	23
β-strand	157-161	5	1
α-helix	163-171	9
α-helix	178-186	9
β-strand	189-190	2	1
α-helix	196-207	12

Chain B: 12 helices, 6 β-strands

Element	Residues	Length	Sheet
β-strand	17	1	2
β-strand	29	1	2
α-helix	31-53	23
α-helix	55-57	3
α-helix	61-84	24
α-helix	87-89	3
β-strand	93-97	5	3
α-helix	100-102	3
α-helix	104-106	3
β-strand	112-116	5	3
α-helix	120-122	3
α-helix	123-143	21
β-strand	160-161	2	3
α-helix	163-171	9
α-helix	178-186	9
β-strand	189-190	2	3
α-helix	196-207	12
α-helix	209-214	6

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
DrrA	A, B	protein	213	Legionella pneumophila subsp. pneumophila	Q29ST3 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>3NKU_1 DrrA (chains A, B)
GHMMSVNEEQFGSLYSDERDKPLLSPTAQKKFEEYQNKLANLSKIIRENEGNEVSPWQEW
ENGLRQIYKEMIYDAFDALGVEMPKDMEVHFAGSLAKAQATEYSDLDAFVIVKNDEDIKK
VKPVFDALNNLCQRIFTASNQIYPDPIGINPSRLIGTPDDLFGMLKDGMVADVEATAMSI
LTSKPVLPRYELGEELRDKIKQEPSFSNMVSAK

Primary citation

The Legionella effector protein DrrA AMPylates the membrane traffic regulator Rab1b. Muller, M.P., Peters, H., Blumer, J. et al. Science (2010) 329:946-949. DOI 10.1126/science.1192276 · PubMed

Other PDB entries of the same protein (UniProt Q29ST3 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6YX5 2.14 Å, Structure of DrrA from Legionella pneumophilia in complex with human Rab8a
5O74 2.5 Å, Crystal structure of human Rab1b covalently bound to the GEF domain of DrrA/SidM from…

Browse structure collections

About this viewer

MolViewer shows 3NKU directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.