Crystal structure of the RNA recognition motif of yeast eIF3b residues 76-161. Determined by X-ray diffraction at 2.6 Å resolution. Released 6 Oct 2010.
Explore 3NS5 in 3D Show helices and sheets RCSB PDB PDBe
3NS5 contains 6 α-helices and 18 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 78-82 | 5 | 1 |
| β-strand | 88 | 1 | 2 |
| α-helix | 89-91 | 3 | |
| α-helix | 92-104 | 13 | |
| β-strand | 111-113 | 3 | 1 |
| β-strand | 116-117 | 2 | 2 |
| β-strand | 122-123 | 2 | 2 |
| β-strand | 127-130 | 4 | 1 |
| α-helix | 134-144 | 11 | |
| β-strand | 148 | 1 | 3 |
| β-strand | 154 | 1 | 3 |
| β-strand | 156-159 | 4 | 1 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 78-82 | 5 | 4 |
| β-strand | 88 | 1 | 5 |
| α-helix | 89-91 | 3 | |
| α-helix | 92-103 | 12 | |
| β-strand | 109-113 | 5 | 4 |
| β-strand | 116-117 | 2 | 5 |
| β-strand | 122-123 | 2 | 5 |
| β-strand | 126-131 | 6 | 4 |
| α-helix | 134-144 | 11 | |
| β-strand | 148 | 1 | 6 |
| β-strand | 154 | 1 | 6 |
| β-strand | 156-159 | 4 | 4 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Eukaryotic translation initiation factor 3 subunit B | A, B | protein | 91 | Saccharomyces cerevisiae | P06103 (AlphaFold model) |
>3NS5_1 Eukaryotic translation initiation factor 3 subunit B (chains A, B) GPLGSDQYIVVNGAPVIPSAKVPVLKKALTSLFSKAGKVVNMEFPIDEATGKTKGFLFVE CGSMNDAKKIIKSFHGKRLDLKHRLFLYTMK
Crystal structure of the RNA recognition motif of yeast translation initiation factor eIF3b reveals differences to human eIF3b. Khoshnevis, S., Neumann, P., Ficner, R. PLoS One (2010) 5:e12784-e12784. DOI 10.1371/journal.pone.0012784 · PubMed
Other PDB entries of the same protein (UniProt P06103 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 3NS5 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.