3NS5: PDB entry 3NS5

Name: PDB 3NS5: Crystal structure of the RNA recognition motif of yeast eIF3b residues 76-161
Published: 2010-10-06
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: translation

Crystal structure of the RNA recognition motif of yeast eIF3b residues 76-161. Determined by X-ray diffraction at 2.6 Å resolution. Released 6 Oct 2010.

Method: X-ray diffraction
Resolution: 2.6 Å
Organism: Saccharomyces cerevisiae
Chains: 2
Atoms: 1,442
Mol. weight: 19.97 kDa
Released: 6 Oct 2010

Explore 3NS5 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3NS5 contains 6 α-helices and 18 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 3 helices, 9 β-strands

Element	Residues	Length	Sheet
β-strand	78-82	5	1
β-strand	88	1	2
α-helix	89-91	3
α-helix	92-104	13
β-strand	111-113	3	1
β-strand	116-117	2	2
β-strand	122-123	2	2
β-strand	127-130	4	1
α-helix	134-144	11
β-strand	148	1	3
β-strand	154	1	3
β-strand	156-159	4	1

Chain B: 3 helices, 9 β-strands

Element	Residues	Length	Sheet
β-strand	78-82	5	4
β-strand	88	1	5
α-helix	89-91	3
α-helix	92-103	12
β-strand	109-113	5	4
β-strand	116-117	2	5
β-strand	122-123	2	5
β-strand	126-131	6	4
α-helix	134-144	11
β-strand	148	1	6
β-strand	154	1	6
β-strand	156-159	4	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Eukaryotic translation initiation factor 3 subunit B	A, B	protein	91	Saccharomyces cerevisiae	P06103 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>3NS5_1 Eukaryotic translation initiation factor 3 subunit B (chains A, B)
GPLGSDQYIVVNGAPVIPSAKVPVLKKALTSLFSKAGKVVNMEFPIDEATGKTKGFLFVE
CGSMNDAKKIIKSFHGKRLDLKHRLFLYTMK

Primary citation

Crystal structure of the RNA recognition motif of yeast translation initiation factor eIF3b reveals differences to human eIF3b. Khoshnevis, S., Neumann, P., Ficner, R. PLoS One (2010) 5:e12784-e12784. DOI 10.1371/journal.pone.0012784 · PubMed

Other PDB entries of the same protein (UniProt P06103 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3NS6 1.25 Å, Crystal structure of hte RNA recognition motif of yeast eIF3b residues 76-170
4U1E 2.0 Å, Crystal structure of the eIF3b-CTD/eIF3i/eIF3g-NTD translation initiation complex
3ZWL 2.2 Å, Structure of eukaryotic translation initiation factor eIF3i complex with eIF3b…
4U1F 2.2 Å, Crystal structure of middle domain of eukaryotic translation initiation factor eIF3b
8CAH 3.0 Å, Cryo-EM structure of native Otu2-bound ubiquitinated 43S pre-initiation complex
6FYY 3.02 Å, Structure of a partial yeast 48S preinitiation complex with eIF5 N-terminal domain…
8CAS 3.3 Å, Cryo-EM structure of native Otu2-bound ubiquitinated 48S initiation complex (partial)
6FYX 3.5 Å, Structure of a partial yeast 48S preinitiation complex with eIF5 N-terminal domain…
3JAP 4.9 Å, Structure of a partial yeast 48S preinitiation complex in closed conformation
6GSM 5.15 Å, Structure of a partial yeast 48S preinitiation complex in open conformation.
6ZCE 5.3 Å, Structure of a yeast ABCE1-bound 43S pre-initiation complex
6GSN 5.75 Å, Structure of a partial yeast 48S preinitiation complex in closed conformation

Browse structure collections

About this viewer

MolViewer shows 3NS5 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.