3NY7: STAS domain of YchM

STAS domain of YchM bound to ACP. Determined by X-ray diffraction at 1.92 Å resolution. Released 1 Dec 2010.

Method: X-ray diffraction
Resolution: 1.92 Å
Organism: Escherichia coli
Chains: 2
Atoms: 1,808
Mol. weight: 22.22 kDa
Ligands: SXM
Released: 1 Dec 2010

Explore 3NY7 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3NY7 contains 12 α-helices and 10 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 5 helices, 8 β-strands

Element	Residues	Length	Sheet
β-strand	438-441	4	1
β-strand	450-456	7	1
β-strand	459	1	2
α-helix	461-472	12
β-strand	480-487	8	1
β-strand	491	1	2
α-helix	493-505	13
α-helix	506-507	2
β-strand	511-515	5	1
α-helix	519-527	9
β-strand	533	1	1
β-strand	537-540	4	1
α-helix	543-546	4

Chain B: 7 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	4-16	13
α-helix	20-22	3
β-strand	28	1	3
α-helix	29-33	5
α-helix	37-51	15
α-helix	54-56	3
α-helix	57-60	4
β-strand	65	1	3
α-helix	66-75	10

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Sulfate transporter	A	protein	118	Escherichia coli	P0AFR2 (AlphaFold model)
Acyl carrier protein	B	protein	78	Escherichia coli	P0A6A8 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>3NY7_1 Sulfate transporter (chains A)
GSHMTRLAPVVVDVPDDVLVLRVIGPLFFAAAEGLFTDLESRLEGKRIVILKWDAVPVLD
AGGLDAFQRFVKRLPEGCELRVCNVEFQPLRTMARAGIQPIPGRLAFFPNRRAAMADL

Sequence of entity 2 (B), FASTA

>3NY7_2 Acyl carrier protein (chains B)
MSTIEERVKKIIGEQLGVKQEEVTNNASFVEDLGADSLDTVELVMALEEEFDTEIPDEEA
EKITTVQAAIDYINGHQA

Ligands and cofactors

ID	Name	Formula	Copies
SXM	3-{[2-({N-[(2S)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}am…	C14 H25 N2 O10 P S	1

Water and common crystallization additives (GOL) are not listed.

Primary citation

Structure of a SLC26 Anion Transporter STAS Domain in Complex with Acyl Carrier Protein: Implications for E. coli YchM in Fatty Acid Metabolism. Babu, M., Greenblatt, J.F., Emili, A. et al. Structure (2010) 18:1450-1462. DOI 10.1016/j.str.2010.08.015 · PubMed

Browse structure collections

About this viewer

MolViewer shows 3NY7 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.